BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0837 (620 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U80024-9|AAK18886.1| 300|Caenorhabditis elegans Serpentine rece... 29 2.0 U42844-7|AAB53819.1| 331|Caenorhabditis elegans Skn-1 dependent... 28 4.7 >U80024-9|AAK18886.1| 300|Caenorhabditis elegans Serpentine receptor, class bc (class b-like) protein 10 protein. Length = 300 Score = 29.5 bits (63), Expect = 2.0 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = -3 Query: 390 LLHNILTFLYCIVILIVLYCNGVFTNSILILEYCVIKLHN 271 L HN I+ILI+ C+G+F +++ + C + L N Sbjct: 127 LFHNYRHRFPSIIILILAVCSGIF-EDLVLFQSCTLNLSN 165 >U42844-7|AAB53819.1| 331|Caenorhabditis elegans Skn-1 dependent zygotic transcriptprotein 2 protein. Length = 331 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/33 (33%), Positives = 22/33 (66%) Frame = +2 Query: 281 FITQYSKIRMELVKTPLQ*RTIKITIQYKNVRI 379 + +S+IR E K+P+ ++I +I+Y+NV + Sbjct: 229 YTDSFSQIRHETSKSPMNAQSINASIEYENVPV 261 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,597,029 Number of Sequences: 27780 Number of extensions: 243629 Number of successful extensions: 559 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 539 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 559 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1353389824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -