BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0835 (614 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1183.07 |||U3 snoRNP-associated protein Rrp5|Schizosaccharom... 26 3.8 SPCC777.15 |||tRNA dihydrouridine synthase Dus4 |Schizosaccharom... 26 3.8 SPAC222.05c |mss1||COX RNA-associated protein|Schizosaccharomyce... 25 8.7 >SPCC1183.07 |||U3 snoRNP-associated protein Rrp5|Schizosaccharomyces pombe|chr 3|||Manual Length = 1690 Score = 26.2 bits (55), Expect = 3.8 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +2 Query: 464 FRTYISRWVPHLHF-RCLWAPVTA*DQVGCELVHTSKQKKSLESSHLT 604 F T+I W PH H + + + D + + KQ K +SS +T Sbjct: 1180 FDTFIKDWKPHFHVNQLVKGSIVGIDNDSKRIEMSLKQSKIKDSSEIT 1227 >SPCC777.15 |||tRNA dihydrouridine synthase Dus4 |Schizosaccharomyces pombe|chr 3|||Manual Length = 326 Score = 26.2 bits (55), Expect = 3.8 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -3 Query: 450 LQRLLRPSNRNALLLHGRTRQGGGTYPRGL 361 L +++ S + + +HGRTRQ ++P L Sbjct: 162 LMQVIEKSGADIITVHGRTRQDRSSFPVNL 191 >SPAC222.05c |mss1||COX RNA-associated protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 496 Score = 25.0 bits (52), Expect = 8.7 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +3 Query: 378 YHHPA*FCREAVMRFGLKGGAAVVTILEILERISQDG 488 + P+ F E V+ L GG AVV + LE I Q G Sbjct: 87 FKKPSSFTGEDVVELQLHGGTAVVDV--TLEAIKQSG 121 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,987,791 Number of Sequences: 5004 Number of extensions: 33594 Number of successful extensions: 63 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 63 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 63 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 269634532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -