BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0834 (441 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33522| Best HMM Match : SCPU (HMM E-Value=6.8) 60 8e-10 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.079 SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) 33 0.10 SB_4480| Best HMM Match : TAT_ubiq (HMM E-Value=8.2) 31 0.32 SB_30796| Best HMM Match : SNARE (HMM E-Value=0.45) 31 0.56 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.74 SB_24972| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.74 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.74 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_25040| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 29 1.7 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_12070| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.0 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.0 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 28 3.0 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.0 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.0 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.0 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.0 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.0 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.0 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.0 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 28 3.0 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.0 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.0 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.0 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 28 3.0 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 28 3.0 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 28 3.9 SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_49230| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 27 5.2 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_39225| Best HMM Match : NIF (HMM E-Value=0) 27 5.2 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 27 5.2 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 27 5.2 SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_35887| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_35283| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_8834| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 27 5.2 SB_2747| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.2 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_51818| Best HMM Match : Cu2_monooxygen (HMM E-Value=2.8e-14) 27 6.9 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_42741| Best HMM Match : CN_hydrolase (HMM E-Value=4.6e-14) 27 6.9 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_36615| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_24705| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_18933| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 27 6.9 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 27 9.1 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 27 9.1 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 27 9.1 SB_16952| Best HMM Match : AAA_5 (HMM E-Value=0.47) 27 9.1 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 27 9.1 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 27 9.1 SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_2216| Best HMM Match : WD40 (HMM E-Value=9.6e-16) 27 9.1 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 >SB_33522| Best HMM Match : SCPU (HMM E-Value=6.8) Length = 295 Score = 60.1 bits (139), Expect = 8e-10 Identities = 26/53 (49%), Positives = 34/53 (64%) Frame = +2 Query: 281 MPILFSIVARGTVVLAKYATCQGNFTEVAEQILSKIPPHDDKLTYSHGNYLFH 439 MP+ +S++ARG +L YA GNF +V IL KIP +D K TY G+Y FH Sbjct: 102 MPLYYSLIARGGTILVDYAETTGNFQQVTYTILEKIPGNDTKCTYVSGSYQFH 154 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.5 bits (73), Expect = 0.079 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -2 Query: 74 FTENMKF*SLVPNSCSPGDPL 12 FT +KF S V NSCSPGDPL Sbjct: 7 FTTWLKFVSKVSNSCSPGDPL 27 >SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) Length = 175 Score = 33.1 bits (72), Expect = 0.10 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 66 KYEILIPRAEFLQPGGST 13 KYE+ P+ EFLQPGGST Sbjct: 44 KYELKAPKIEFLQPGGST 61 >SB_4480| Best HMM Match : TAT_ubiq (HMM E-Value=8.2) Length = 107 Score = 31.5 bits (68), Expect = 0.32 Identities = 19/37 (51%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = +1 Query: 13 SGSPGLQEFGTRD*NFIFS-VN-RYTINIPNSFQENQ 117 SGSPGLQEF D N I VN R T +P+S + N+ Sbjct: 15 SGSPGLQEFDDEDINRILKHVNIRKTSRVPSSTKANK 51 >SB_30796| Best HMM Match : SNARE (HMM E-Value=0.45) Length = 299 Score = 30.7 bits (66), Expect = 0.56 Identities = 13/40 (32%), Positives = 26/40 (65%) Frame = +2 Query: 107 KKINLYLIFSVTVIAR*LFSSLNKYLSKILFHYLKKVCVC 226 KK+N Y + + ++AR +++ +YL+K F YL ++ +C Sbjct: 39 KKVNRYKLIYIRIVARDMYTEGWRYLTK--FSYLMELALC 76 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 30.3 bits (65), Expect = 0.74 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -2 Query: 83 VYLFTENMKF*SLVPNSCSPGDPL 12 +Y F E + F L+ NSCSPGDPL Sbjct: 7 LYGFVELISF--LISNSCSPGDPL 28 >SB_24972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 30.3 bits (65), Expect = 0.74 Identities = 17/37 (45%), Positives = 21/37 (56%) Frame = -1 Query: 123 YKLIFLK*IRYVYGIPIY*KYEILIPRAEFLQPGGST 13 YK FLK R + + + + L P EFLQPGGST Sbjct: 32 YKPAFLK--RQILRVANISRIDALRPNIEFLQPGGST 66 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.3 bits (65), Expect = 0.74 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -2 Query: 74 FTENMKF*SLVPNSCSPGDPL 12 FT+ + ++V NSCSPGDPL Sbjct: 4 FTDTLISANIVSNSCSPGDPL 24 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.9 bits (64), Expect = 0.97 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -2 Query: 74 FTENMKF*SLVPNSCSPGDPL 12 FT+ + +++ NSCSPGDPL Sbjct: 4 FTDTLISANIISNSCSPGDPL 24 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.9 bits (64), Expect = 0.97 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -2 Query: 74 FTENMKF*SLVPNSCSPGDPL 12 FT+ + +++ NSCSPGDPL Sbjct: 4 FTDTLISANIISNSCSPGDPL 24 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 1.3 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 SL+ NSCSPGDPL Sbjct: 32 SLISNSCSPGDPL 44 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 1.3 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 SL+ NSCSPGDPL Sbjct: 32 SLISNSCSPGDPL 44 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 1.3 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 SL+ NSCSPGDPL Sbjct: 32 SLISNSCSPGDPL 44 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 1.3 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 SL+ NSCSPGDPL Sbjct: 32 SLISNSCSPGDPL 44 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 1.3 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 SL+ NSCSPGDPL Sbjct: 32 SLISNSCSPGDPL 44 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 1.3 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 SL+ NSCSPGDPL Sbjct: 32 SLISNSCSPGDPL 44 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 1.3 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 SL+ NSCSPGDPL Sbjct: 32 SLISNSCSPGDPL 44 >SB_25040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 456 Score = 29.5 bits (63), Expect = 1.3 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +1 Query: 28 LQEFGTRD*NFIFSVNRYTINIPNSFQENQFIPNIFCHGHC 150 ++ ++D N R+ IN+P+ F+ N ++ FC HC Sbjct: 126 MRALASKDINAQLLKERFNINMPHKFKVNNYLSPTFC-DHC 165 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 29.5 bits (63), Expect = 1.3 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 SL+ NSCSPGDPL Sbjct: 33 SLISNSCSPGDPL 45 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 1.3 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 SL+ NSCSPGDPL Sbjct: 32 SLISNSCSPGDPL 44 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.5 bits (63), Expect = 1.3 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 SL+ NSCSPGDPL Sbjct: 30 SLISNSCSPGDPL 42 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 29.1 bits (62), Expect = 1.7 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 S+V NSCSPGDPL Sbjct: 346 SIVSNSCSPGDPL 358 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 29.1 bits (62), Expect = 1.7 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -1 Query: 63 YEILIPRAEFLQPGGST 13 Y+ + P EFLQPGGST Sbjct: 108 YDFIYPGIEFLQPGGST 124 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.1 bits (62), Expect = 1.7 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -2 Query: 74 FTENMKF*SLVPNSCSPGDPL 12 FT+ + +++ NSCSPGDPL Sbjct: 4 FTDTLISANILSNSCSPGDPL 24 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.1 bits (62), Expect = 1.7 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -2 Query: 74 FTENMKF*SLVPNSCSPGDPL 12 FT + K +L NSCSPGDPL Sbjct: 14 FTGHAKNDALSSNSCSPGDPL 34 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 29.1 bits (62), Expect = 1.7 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -2 Query: 71 TENMKF*SLVPNSCSPGDPL 12 +EN++ V NSCSPGDPL Sbjct: 50 SENLRTIPPVSNSCSPGDPL 69 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 29.1 bits (62), Expect = 1.7 Identities = 13/21 (61%), Positives = 16/21 (76%), Gaps = 1/21 (4%) Frame = -2 Query: 71 TENM-KF*SLVPNSCSPGDPL 12 +EN+ F L+ NSCSPGDPL Sbjct: 31 SENLWTFKHLISNSCSPGDPL 51 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 2.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -2 Query: 74 FTENMKF*SLVPNSCSPGDPL 12 FT+ + ++ NSCSPGDPL Sbjct: 4 FTDTLISANIASNSCSPGDPL 24 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 28.7 bits (61), Expect = 2.2 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 56 F*SLVPNSCSPGDPL 12 F L+ NSCSPGDPL Sbjct: 34 FLDLISNSCSPGDPL 48 >SB_12070| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 28.7 bits (61), Expect = 2.2 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = -1 Query: 90 VYGIPIY*KYEILIPRAEFLQPGGST 13 VYG +E LI EFLQPGGST Sbjct: 15 VYGHSKQKWFEFLIGDIEFLQPGGST 40 >SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.7 bits (61), Expect = 2.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -2 Query: 74 FTENMKF*SLVPNSCSPGDPL 12 FT+ + ++ NSCSPGDPL Sbjct: 4 FTDTLISANITSNSCSPGDPL 24 >SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 28.7 bits (61), Expect = 2.2 Identities = 16/29 (55%), Positives = 18/29 (62%) Frame = -2 Query: 98 FGMFMVYLFTENMKF*SLVPNSCSPGDPL 12 FG F +F E +F L NSCSPGDPL Sbjct: 51 FG-FSGIIFMEG-RFPKLSSNSCSPGDPL 77 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.7 bits (61), Expect = 2.2 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -2 Query: 77 LFTENMKF*SLVPNSCSPGDPL 12 L + N+ F L+ NSCSPGDPL Sbjct: 8 LISANIVF--LISNSCSPGDPL 27 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.3 bits (60), Expect = 3.0 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 LV NSCSPGDPL Sbjct: 24 LVSNSCSPGDPL 35 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.3 bits (60), Expect = 3.0 Identities = 13/23 (56%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = -2 Query: 77 LFTENMKF*SLVP-NSCSPGDPL 12 L +N+ + L+P NSCSPGDPL Sbjct: 14 LLLKNVVWLQLLPSNSCSPGDPL 36 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 28.3 bits (60), Expect = 3.0 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 68 ENMKF*SLVPNSCSPGDPL 12 E K+ S NSCSPGDPL Sbjct: 11 EQGKYKSSTSNSCSPGDPL 29 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 3.0 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 LV NSCSPGDPL Sbjct: 3 LVSNSCSPGDPL 14 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.3 bits (60), Expect = 3.0 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 LV NSCSPGDPL Sbjct: 17 LVSNSCSPGDPL 28 >SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 28.3 bits (60), Expect = 3.0 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -2 Query: 77 LFTENMKF*SLVPNSCSPGDPL 12 L + N+KF S NSCSPGDPL Sbjct: 8 LISANIKFRS---NSCSPGDPL 26 >SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 28.3 bits (60), Expect = 3.0 Identities = 16/31 (51%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -2 Query: 101 EFGMF-MVYLFTENMKF*SLVPNSCSPGDPL 12 EFG+ V E+ K S NSCSPGDPL Sbjct: 538 EFGLIGSVEWVEEHSKILSDRSNSCSPGDPL 568 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.3 bits (60), Expect = 3.0 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 LV NSCSPGDPL Sbjct: 9 LVSNSCSPGDPL 20 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.3 bits (60), Expect = 3.0 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 LV NSCSPGDPL Sbjct: 5 LVSNSCSPGDPL 16 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 3.0 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 LV NSCSPGDPL Sbjct: 2 LVSNSCSPGDPL 13 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 28.3 bits (60), Expect = 3.0 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 S V NSCSPGDPL Sbjct: 12 SFVSNSCSPGDPL 24 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 28.3 bits (60), Expect = 3.0 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 56 F*SLVPNSCSPGDPL 12 F L+ NSCSPGDPL Sbjct: 67 FPCLISNSCSPGDPL 81 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.3 bits (60), Expect = 3.0 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 LV NSCSPGDPL Sbjct: 26 LVSNSCSPGDPL 37 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.3 bits (60), Expect = 3.0 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 LV NSCSPGDPL Sbjct: 26 LVSNSCSPGDPL 37 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 28.3 bits (60), Expect = 3.0 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 SL NSCSPGDPL Sbjct: 14 SLTSNSCSPGDPL 26 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 28.3 bits (60), Expect = 3.0 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +2 Query: 14 VDPPGCRNSARGIKIS 61 VDPPGCRNS G +S Sbjct: 103 VDPPGCRNSITGGPVS 118 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.9 bits (59), Expect = 3.9 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 77 LFTENMKF*SLVPNSCSPGDPL 12 L + N+K NSCSPGDPL Sbjct: 8 LISANIKGRHCASNSCSPGDPL 29 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 27.9 bits (59), Expect = 3.9 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +2 Query: 14 VDPPGCRNSARGI 52 VDPPGCRNS R + Sbjct: 16 VDPPGCRNSIRTV 28 >SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 27.9 bits (59), Expect = 3.9 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 48 PRAEFLQPGGST 13 PR EFLQPGGST Sbjct: 40 PRIEFLQPGGST 51 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 27.9 bits (59), Expect = 3.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 ++V NSCSPGDPL Sbjct: 76 TIVSNSCSPGDPL 88 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.9 bits (59), Expect = 3.9 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 L+ NSCSPGDPL Sbjct: 8 LISNSCSPGDPL 19 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.9 bits (59), Expect = 3.9 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 62 MKF*SLVPNSCSPGDPL 12 M + +L NSCSPGDPL Sbjct: 1 MLYNTLASNSCSPGDPL 17 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.9 bits (59), Expect = 3.9 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -2 Query: 77 LFTENMKF*SLVPNSCSPGDPL 12 L + N+ + V NSCSPGDPL Sbjct: 8 LISANIISIAFVSNSCSPGDPL 29 >SB_49230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.9 bits (59), Expect = 3.9 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -1 Query: 51 IPRAEFLQPGGST 13 +P+ EFLQPGGST Sbjct: 5 VPKIEFLQPGGST 17 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 27.9 bits (59), Expect = 3.9 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +2 Query: 14 VDPPGCRNSARGIKIS 61 VDPPGCRNS G +S Sbjct: 33 VDPPGCRNSIDGNGVS 48 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.9 bits (59), Expect = 3.9 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 L+ NSCSPGDPL Sbjct: 24 LISNSCSPGDPL 35 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 27.9 bits (59), Expect = 3.9 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = +2 Query: 14 VDPPGCRNSARG 49 VDPPGCRNS G Sbjct: 16 VDPPGCRNSIEG 27 >SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.9 bits (59), Expect = 3.9 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -2 Query: 74 FTENMKF*SLVPNSCSPGDPL 12 FT+ + ++ NSCSPGDPL Sbjct: 4 FTDTLISANIPSNSCSPGDPL 24 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 27.9 bits (59), Expect = 3.9 Identities = 15/27 (55%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +2 Query: 14 VDPPGCRNSARG-IKISYFQ*IGIP*T 91 VDPPGCRNS R I+ F I P T Sbjct: 16 VDPPGCRNSIRSTTTITIFTIIKTPMT 42 >SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 27.9 bits (59), Expect = 3.9 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -2 Query: 74 FTENMKF*SLVPNSCSPGDPL 12 FT+ + ++ NSCSPGDPL Sbjct: 4 FTDTLISANIQSNSCSPGDPL 24 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 27.9 bits (59), Expect = 3.9 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 L+ NSCSPGDPL Sbjct: 21 LISNSCSPGDPL 32 >SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.9 bits (59), Expect = 3.9 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -2 Query: 74 FTENMKF*SLVPNSCSPGDPL 12 FT+ + ++ NSCSPGDPL Sbjct: 4 FTDTLISANIPSNSCSPGDPL 24 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 27.5 bits (58), Expect = 5.2 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 S V NSCSPGDPL Sbjct: 13 SQVSNSCSPGDPL 25 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 27.5 bits (58), Expect = 5.2 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 +L+ NSCSPGDPL Sbjct: 61 TLLSNSCSPGDPL 73 >SB_39225| Best HMM Match : NIF (HMM E-Value=0) Length = 1772 Score = 27.5 bits (58), Expect = 5.2 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 300 ILNNIGIVNNRVNDTKNTMLPNHYLHTHTFFR*W-NKILDK 181 I + +V + D ++ +LP H + HT FR W +K L K Sbjct: 1090 IHTTVQLVPANMKDVQHFVLPGHPMWYHTKFRPWAHKFLQK 1130 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 27.5 bits (58), Expect = 5.2 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -2 Query: 95 GMFMVYLFTENMKF*SLVPNSCSPGDPL 12 G +M+++ K + NSCSPGDPL Sbjct: 67 GDYMIFI-RRGAKRQQMASNSCSPGDPL 93 >SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.5 bits (58), Expect = 5.2 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 Query: 65 NMKF*SLVPNSCSPGDPL 12 N F + NSCSPGDPL Sbjct: 5 NSNFWIVTSNSCSPGDPL 22 >SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) Length = 128 Score = 27.5 bits (58), Expect = 5.2 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 SL NSCSPGDPL Sbjct: 3 SLSSNSCSPGDPL 15 >SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.5 bits (58), Expect = 5.2 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 77 LFTENMKF*SLVPNSCSPGDPL 12 L + N+ + NSCSPGDPL Sbjct: 8 LISANIILIKITSNSCSPGDPL 29 >SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 5.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -2 Query: 74 FTENMKF*SLVPNSCSPGDPL 12 FT+ + ++ NSCSPGDPL Sbjct: 4 FTDTLISANIGSNSCSPGDPL 24 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 5.2 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 +L+ NSCSPGDPL Sbjct: 1 TLLSNSCSPGDPL 13 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 5.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 +V NSCSPGDPL Sbjct: 11 MVSNSCSPGDPL 22 >SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.5 bits (58), Expect = 5.2 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 S+ NSCSPGDPL Sbjct: 33 SITSNSCSPGDPL 45 >SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) Length = 210 Score = 27.5 bits (58), Expect = 5.2 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -2 Query: 89 FMVYLFTENMKF*SLVPNSCSPGDPL 12 ++ YL K L NSCSPGDPL Sbjct: 71 YVEYLHESVPKSEPLSSNSCSPGDPL 96 >SB_42272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.5 bits (58), Expect = 5.2 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 59 KF*SLVPNSCSPGDPL 12 KF + NSCSPGDPL Sbjct: 8 KFYRIQSNSCSPGDPL 23 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.5 bits (58), Expect = 5.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 +V NSCSPGDPL Sbjct: 1 MVSNSCSPGDPL 12 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.5 bits (58), Expect = 5.2 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 ++V NSCSPGDPL Sbjct: 18 TVVSNSCSPGDPL 30 >SB_35887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 983 Score = 27.5 bits (58), Expect = 5.2 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -1 Query: 336 AYLARTTVPLATILNNIGIVNNRVNDTKN 250 AY+A++T + T L+N+ VND K+ Sbjct: 117 AYMAKSTAAVQTALDNLASAEEDVNDLKS 145 >SB_35283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.5 bits (58), Expect = 5.2 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 60 EILIPRAEFLQPGGST 13 + L+ R EFLQPGGST Sbjct: 14 DTLLERIEFLQPGGST 29 >SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 5.2 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 SL NSCSPGDPL Sbjct: 5 SLSSNSCSPGDPL 17 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 27.5 bits (58), Expect = 5.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 +V NSCSPGDPL Sbjct: 85 IVSNSCSPGDPL 96 >SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 5.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -2 Query: 74 FTENMKF*SLVPNSCSPGDPL 12 FT+ + ++ NSCSPGDPL Sbjct: 4 FTDTLISANIRSNSCSPGDPL 24 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.5 bits (58), Expect = 5.2 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 +++ NSCSPGDPL Sbjct: 3 TIISNSCSPGDPL 15 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.5 bits (58), Expect = 5.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 +V NSCSPGDPL Sbjct: 6 IVSNSCSPGDPL 17 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.5 bits (58), Expect = 5.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 +V NSCSPGDPL Sbjct: 1 MVSNSCSPGDPL 12 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 27.5 bits (58), Expect = 5.2 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = +2 Query: 14 VDPPGCRNSARG 49 VDPPGCRNS G Sbjct: 92 VDPPGCRNSIAG 103 >SB_8834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 5.2 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -2 Query: 74 FTENMKF*SLVPNSCSPGDPL 12 FT+ + ++ NSCSPGDPL Sbjct: 4 FTDTLISANIGSNSCSPGDPL 24 >SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) Length = 144 Score = 27.5 bits (58), Expect = 5.2 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 S+ NSCSPGDPL Sbjct: 18 SITSNSCSPGDPL 30 >SB_2747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 27.5 bits (58), Expect = 5.2 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 59 KF*SLVPNSCSPGDPL 12 KF NSCSPGDPL Sbjct: 33 KFKKCTSNSCSPGDPL 48 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.1 bits (57), Expect = 6.9 Identities = 13/16 (81%), Positives = 13/16 (81%), Gaps = 3/16 (18%) Frame = -2 Query: 50 SLVP---NSCSPGDPL 12 SLVP NSCSPGDPL Sbjct: 21 SLVPRPSNSCSPGDPL 36 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.1 bits (57), Expect = 6.9 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 ++ NSCSPGDPL Sbjct: 17 IISNSCSPGDPL 28 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.1 bits (57), Expect = 6.9 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -1 Query: 75 IY*KYEILIPRAEFLQPGGST 13 +Y ++ P EFLQPGGST Sbjct: 14 VYLLFDATKPSIEFLQPGGST 34 >SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 27.1 bits (57), Expect = 6.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +2 Query: 14 VDPPGCRNSARGIKISY 64 VDPPGCRNS I Y Sbjct: 16 VDPPGCRNSINTINHIY 32 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 27.1 bits (57), Expect = 6.9 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 14 VDPPGCRNSARGIKIS 61 VDPPGCRNS + S Sbjct: 16 VDPPGCRNSMENARTS 31 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.1 bits (57), Expect = 6.9 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 +L NSCSPGDPL Sbjct: 14 ALTSNSCSPGDPL 26 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 27.1 bits (57), Expect = 6.9 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 ++ NSCSPGDPL Sbjct: 119 IISNSCSPGDPL 130 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 27.1 bits (57), Expect = 6.9 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 S + NSCSPGDPL Sbjct: 57 SSISNSCSPGDPL 69 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 27.1 bits (57), Expect = 6.9 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 +V NSCSPGDPL Sbjct: 3474 VVSNSCSPGDPL 3485 >SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.1 bits (57), Expect = 6.9 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 S + NSCSPGDPL Sbjct: 2 SQISNSCSPGDPL 14 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.1 bits (57), Expect = 6.9 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 ++ NSCSPGDPL Sbjct: 14 IISNSCSPGDPL 25 >SB_51818| Best HMM Match : Cu2_monooxygen (HMM E-Value=2.8e-14) Length = 239 Score = 27.1 bits (57), Expect = 6.9 Identities = 16/68 (23%), Positives = 27/68 (39%) Frame = -1 Query: 408 NLSSWGGIFDKICSATSVKLP*QVAYLARTTVPLATILNNIGIVNNRVNDTKNTMLPNHY 229 N G + + +C+ S K ++ Y P + + + +D K +L HY Sbjct: 133 NCGEMGDVQNGVCAQGSAK---KILYAWAGNAPSLDLPEGVAFKVGQDSDVKYLVLQVHY 189 Query: 228 LHTHTFFR 205 H FFR Sbjct: 190 GHVDKFFR 197 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.1 bits (57), Expect = 6.9 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 +V NSCSPGDPL Sbjct: 7 VVSNSCSPGDPL 18 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 27.1 bits (57), Expect = 6.9 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 L+ NSCSPGDPL Sbjct: 54 LLSNSCSPGDPL 65 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 27.1 bits (57), Expect = 6.9 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 14 VDPPGCRNSARGIKISYF 67 VDPPGCRNS + + F Sbjct: 16 VDPPGCRNSIQARSVDGF 33 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.1 bits (57), Expect = 6.9 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 L+ NSCSPGDPL Sbjct: 6 LLSNSCSPGDPL 17 >SB_42741| Best HMM Match : CN_hydrolase (HMM E-Value=4.6e-14) Length = 255 Score = 27.1 bits (57), Expect = 6.9 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 Query: 294 SVSWLEAL*SSLNMQLVRVISLKSQSRFYQR 386 SVSWL+ ++L+ +V I +K Q +Y R Sbjct: 61 SVSWLKQKAATLDAAIVGSIIIKEQENYYNR 91 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.1 bits (57), Expect = 6.9 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 ++ NSCSPGDPL Sbjct: 5 IISNSCSPGDPL 16 >SB_36615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.1 bits (57), Expect = 6.9 Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = -1 Query: 84 GIPIY*KY-EILIPRAEFLQPGGST 13 G +Y Y E ++ + EFLQPGGST Sbjct: 2 GETLYLTYAEAVLQKIEFLQPGGST 26 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.1 bits (57), Expect = 6.9 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 +++ NSCSPGDPL Sbjct: 4 NVISNSCSPGDPL 16 >SB_24705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 27.1 bits (57), Expect = 6.9 Identities = 18/60 (30%), Positives = 30/60 (50%) Frame = -1 Query: 192 ILDKYLFKLENNYRAMTVTENIRYKLIFLK*IRYVYGIPIY*KYEILIPRAEFLQPGGST 13 +++K K +N Y + TV NI + + + Y+ + + + EFLQPGGST Sbjct: 12 LINKCKCKTKNEYIS-TVARNIYHATVEMYSFFYLDSVGDWVLHATRKRSIEFLQPGGST 70 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.1 bits (57), Expect = 6.9 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -2 Query: 71 TENMKF*SLVPNSCSPGDPL 12 TE + + V NSCSPGDPL Sbjct: 2 TEEFRI-TAVSNSCSPGDPL 20 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.1 bits (57), Expect = 6.9 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 ++ NSCSPGDPL Sbjct: 1 MISNSCSPGDPL 12 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.1 bits (57), Expect = 6.9 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 56 F*SLVPNSCSPGDPL 12 F L NSCSPGDPL Sbjct: 8 FIMLASNSCSPGDPL 22 >SB_18933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.1 bits (57), Expect = 6.9 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 S+ NSCSPGDPL Sbjct: 6 SVTSNSCSPGDPL 18 >SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 27.1 bits (57), Expect = 6.9 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 83 VYLFTENMKF*SLVPNSCSPGDPL 12 V LF EN S NSCSPGDPL Sbjct: 45 VTLFIENRLMRS---NSCSPGDPL 65 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.1 bits (57), Expect = 6.9 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 L+ NSCSPGDPL Sbjct: 1 LLSNSCSPGDPL 12 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.1 bits (57), Expect = 6.9 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 56 F*SLVPNSCSPGDPL 12 F V NSCSPGDPL Sbjct: 4 FCEAVSNSCSPGDPL 18 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 27.1 bits (57), Expect = 6.9 Identities = 12/13 (92%), Positives = 12/13 (92%), Gaps = 1/13 (7%) Frame = -2 Query: 47 LVP-NSCSPGDPL 12 LVP NSCSPGDPL Sbjct: 27 LVPSNSCSPGDPL 39 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.1 bits (57), Expect = 6.9 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = -2 Query: 77 LFTENMKF*SLVPNSCSPGDPL 12 +F+E + + V NSCSPGDPL Sbjct: 13 IFSEPKRV-NAVSNSCSPGDPL 33 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.1 bits (57), Expect = 6.9 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 L+ NSCSPGDPL Sbjct: 7 LLSNSCSPGDPL 18 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.1 bits (57), Expect = 6.9 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 +L NSCSPGDPL Sbjct: 2 TLASNSCSPGDPL 14 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 27.1 bits (57), Expect = 6.9 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 +V NSCSPGDPL Sbjct: 27 VVSNSCSPGDPL 38 >SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 27.1 bits (57), Expect = 6.9 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 S + NSCSPGDPL Sbjct: 4 SKISNSCSPGDPL 16 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.1 bits (57), Expect = 6.9 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 59 KF*SLVPNSCSPGDPL 12 K V NSCSPGDPL Sbjct: 12 KIADFVSNSCSPGDPL 27 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 27.1 bits (57), Expect = 6.9 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 ++ NSCSPGDPL Sbjct: 26 IISNSCSPGDPL 37 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 27.1 bits (57), Expect = 6.9 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 +L NSCSPGDPL Sbjct: 95 ALASNSCSPGDPL 107 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.1 bits (57), Expect = 6.9 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 56 F*SLVPNSCSPGDPL 12 F + V NSCSPGDPL Sbjct: 6 FINSVSNSCSPGDPL 20 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 30 VSNSCSPGDPL 40 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = +2 Query: 14 VDPPGCRNSARG 49 VDPPGCRNS G Sbjct: 16 VDPPGCRNSMIG 27 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 7 VSNSCSPGDPL 17 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 10 VSNSCSPGDPL 20 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 S NSCSPGDPL Sbjct: 12 SFTSNSCSPGDPL 24 >SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 26.6 bits (56), Expect = 9.1 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +2 Query: 14 VDPPGCRNSARGIKISYFQ*IGIP*TYRIH 103 VDPPGCRNS +Y P + +H Sbjct: 16 VDPPGCRNSIGQNGFTYMNNRQKPNRFHVH 45 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 2 VSNSCSPGDPL 12 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 40 VSNSCSPGDPL 50 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 117 VSNSCSPGDPL 127 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 184 VSNSCSPGDPL 194 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 34 VSNSCSPGDPL 44 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 1066 VSNSCSPGDPL 1076 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 26.6 bits (56), Expect = 9.1 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 ++ NSCSPGDPL Sbjct: 14 VISNSCSPGDPL 25 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 L NSCSPGDPL Sbjct: 78 LTSNSCSPGDPL 89 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 3 VSNSCSPGDPL 13 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 214 VSNSCSPGDPL 224 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +2 Query: 14 VDPPGCRNSARGIK 55 VDPPGCRNS I+ Sbjct: 16 VDPPGCRNSIEVIR 29 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 32 VSNSCSPGDPL 42 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 L NSCSPGDPL Sbjct: 5 LASNSCSPGDPL 16 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 5 VSNSCSPGDPL 15 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 3 VSNSCSPGDPL 13 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 7 VSNSCSPGDPL 17 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 64 VSNSCSPGDPL 74 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 4 VSNSCSPGDPL 14 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 4 VSNSCSPGDPL 14 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 11 VSNSCSPGDPL 21 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 25 VSNSCSPGDPL 35 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 15 VSNSCSPGDPL 25 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 L NSCSPGDPL Sbjct: 17 LASNSCSPGDPL 28 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 10 VSNSCSPGDPL 20 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 31 VSNSCSPGDPL 41 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 4 VSNSCSPGDPL 14 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 41 VSNSCSPGDPL 51 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 15 VSNSCSPGDPL 25 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 4 VSNSCSPGDPL 14 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 6 VSNSCSPGDPL 16 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 26.6 bits (56), Expect = 9.1 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +2 Query: 14 VDPPGCRNSARGIKISY 64 VDPPGCRNS +SY Sbjct: 16 VDPPGCRNSMNA-NVSY 31 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 15 VSNSCSPGDPL 25 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 L NSCSPGDPL Sbjct: 37 LTSNSCSPGDPL 48 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 18 VSNSCSPGDPL 28 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 L NSCSPGDPL Sbjct: 20 LASNSCSPGDPL 31 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 L NSCSPGDPL Sbjct: 11 LTSNSCSPGDPL 22 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 30 VSNSCSPGDPL 40 >SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 26.6 bits (56), Expect = 9.1 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -2 Query: 74 FTENMKF*SLVPNSCSPGDPL 12 F EN++ + NSCSPGDPL Sbjct: 6 FDENVR--CDISNSCSPGDPL 24 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 32 VSNSCSPGDPL 42 >SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 402 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -2 Query: 62 MKF*SLVPNSCSPGDPL 12 M++ + NSCSPGDPL Sbjct: 165 MQYELFLSNSCSPGDPL 181 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 14 VSNSCSPGDPL 24 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 34 VSNSCSPGDPL 44 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 L NSCSPGDPL Sbjct: 88 LTSNSCSPGDPL 99 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 26.6 bits (56), Expect = 9.1 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 ++ NSCSPGDPL Sbjct: 17 VISNSCSPGDPL 28 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 26.6 bits (56), Expect = 9.1 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -2 Query: 50 SLVPNSCSPGDPL 12 + + NSCSPGDPL Sbjct: 50 AFISNSCSPGDPL 62 >SB_16952| Best HMM Match : AAA_5 (HMM E-Value=0.47) Length = 1345 Score = 26.6 bits (56), Expect = 9.1 Identities = 9/33 (27%), Positives = 20/33 (60%) Frame = +2 Query: 290 LFSIVARGTVVLAKYATCQGNFTEVAEQILSKI 388 ++++ T LAKY CQG ++ E++++ + Sbjct: 1133 IYALEGEATHYLAKYDVCQGIEDQIREKVVASV 1165 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 10 VSNSCSPGDPL 20 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 18 VSNSCSPGDPL 28 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 L NSCSPGDPL Sbjct: 11 LASNSCSPGDPL 22 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 L NSCSPGDPL Sbjct: 661 LASNSCSPGDPL 672 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 27 VSNSCSPGDPL 37 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 L NSCSPGDPL Sbjct: 7 LASNSCSPGDPL 18 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 193 VSNSCSPGDPL 203 >SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 26.6 bits (56), Expect = 9.1 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 68 ENMKF*SLVPNSCSPGDPL 12 EN + + NSCSPGDPL Sbjct: 43 ENKRRVYVTSNSCSPGDPL 61 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -2 Query: 44 VPNSCSPGDPL 12 V NSCSPGDPL Sbjct: 9 VSNSCSPGDPL 19 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 26.6 bits (56), Expect = 9.1 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 ++ NSCSPGDPL Sbjct: 25 VISNSCSPGDPL 36 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 L NSCSPGDPL Sbjct: 11 LTSNSCSPGDPL 22 >SB_2216| Best HMM Match : WD40 (HMM E-Value=9.6e-16) Length = 400 Score = 26.6 bits (56), Expect = 9.1 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -3 Query: 310 SSHDTE*YRHCE*SRKRHKEHNVTKSLFTH 221 S+H RHC SR R N+ + FTH Sbjct: 309 STHARHPVRHCRFSRNRMLTANIPEGQFTH 338 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 26.6 bits (56), Expect = 9.1 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -2 Query: 47 LVPNSCSPGDPL 12 L NSCSPGDPL Sbjct: 4 LASNSCSPGDPL 15 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,506,409 Number of Sequences: 59808 Number of extensions: 259309 Number of successful extensions: 2053 Number of sequences better than 10.0: 195 Number of HSP's better than 10.0 without gapping: 2028 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2053 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 859323430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -