BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0829 (639 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g70310.1 68414.m08089 spermidine synthase 2 (SPDSYN2) / putre... 100 2e-21 At1g23820.2 68414.m03004 spermidine synthase 1 (SPDSYN1) / putre... 99 3e-21 At1g23820.1 68414.m03005 spermidine synthase 1 (SPDSYN1) / putre... 99 3e-21 At5g53120.3 68418.m06603 spermidine synthase, putative / putresc... 94 8e-20 At5g53120.2 68418.m06602 spermidine synthase, putative / putresc... 94 8e-20 At5g53120.1 68418.m06601 spermidine synthase, putative / putresc... 94 8e-20 At5g19530.1 68418.m02326 spermine/spermidine synthase family pro... 66 2e-11 At2g04920.1 68415.m00513 F-box family protein (FBX9) identical t... 31 0.65 At4g14580.1 68417.m02244 CBL-interacting protein kinase 4 (CIPK4... 30 1.1 At4g11800.1 68417.m01879 calcineurin-like phosphoesterase family... 29 2.6 At3g04350.1 68416.m00460 expressed protein 29 2.6 At5g20570.1 68418.m02442 ring-box protein-related similar to rin... 29 3.4 At5g11300.1 68418.m01319 cyclin, putative (CYC3b) similar to cyc... 28 4.5 At1g14460.1 68414.m01715 DNA polymerase-related weak similarity ... 28 6.0 >At1g70310.1 68414.m08089 spermidine synthase 2 (SPDSYN2) / putrescine aminopropyltransferase 2 identical to SP|O48661 Spermidine synthase 2 (EC 2.5.1.16) (Putrescine aminopropyltransferase 2) (SPDSY 2) {Arabidopsis thaliana} Length = 340 Score = 99.5 bits (237), Expect = 2e-21 Identities = 43/88 (48%), Positives = 61/88 (69%) Frame = +3 Query: 375 MDKLKTNWFTESCDMWPGGTFSFEVKEVLHTEKSKYQNIQVFDTTSLGKVLVLDGIIQCT 554 M + WF+E MWPG S +V+++L KS YQ++ VF + + GKVLVLDG+IQ T Sbjct: 44 MSSIIPGWFSEISPMWPGEAHSLKVEKILFQGKSDYQDVIVFQSATYGKVLVLDGVIQLT 103 Query: 555 QKDEFSYQEMISFLPLCCHKNPENVLIV 638 ++DE +YQEMI+ LPLC NP+ VL++ Sbjct: 104 ERDECAYQEMITHLPLCSISNPKKVLVI 131 >At1g23820.2 68414.m03004 spermidine synthase 1 (SPDSYN1) / putrescine aminopropyltransferase 1 identical to SP|Q9ZUB3 Spermidine synthase 1 (EC 2.5.1.16) (Putrescine aminopropyltransferase 1) (SPDSY 1) {Arabidopsis thaliana} Length = 283 Score = 98.7 bits (235), Expect = 3e-21 Identities = 43/81 (53%), Positives = 59/81 (72%) Frame = +3 Query: 396 WFTESCDMWPGGTFSFEVKEVLHTEKSKYQNIQVFDTTSLGKVLVLDGIIQCTQKDEFSY 575 WF+E MWPG S +V++VL KS YQ++ VF + + GKVLVLDG+IQ T++DE +Y Sbjct: 47 WFSEMSPMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVIQLTERDECAY 106 Query: 576 QEMISFLPLCCHKNPENVLIV 638 QEMI+ LPLC NP+ VL++ Sbjct: 107 QEMITHLPLCSIPNPKKVLVI 127 >At1g23820.1 68414.m03005 spermidine synthase 1 (SPDSYN1) / putrescine aminopropyltransferase 1 identical to SP|Q9ZUB3 Spermidine synthase 1 (EC 2.5.1.16) (Putrescine aminopropyltransferase 1) (SPDSY 1) {Arabidopsis thaliana} Length = 334 Score = 98.7 bits (235), Expect = 3e-21 Identities = 43/81 (53%), Positives = 59/81 (72%) Frame = +3 Query: 396 WFTESCDMWPGGTFSFEVKEVLHTEKSKYQNIQVFDTTSLGKVLVLDGIIQCTQKDEFSY 575 WF+E MWPG S +V++VL KS YQ++ VF + + GKVLVLDG+IQ T++DE +Y Sbjct: 47 WFSEMSPMWPGEAHSLKVEKVLFQGKSDYQDVIVFQSATYGKVLVLDGVIQLTERDECAY 106 Query: 576 QEMISFLPLCCHKNPENVLIV 638 QEMI+ LPLC NP+ VL++ Sbjct: 107 QEMITHLPLCSIPNPKKVLVI 127 >At5g53120.3 68418.m06603 spermidine synthase, putative / putrescine aminopropyltransferase, putative similar to SP|O82147 Spermidine synthase (EC 2.5.1.16) (Putrescine aminopropyltransferase) (SPDSY) {Coffea arabica}; contains Pfam profile PF01564: Spermine/spermidine synthase Length = 359 Score = 93.9 bits (223), Expect = 8e-20 Identities = 41/74 (55%), Positives = 57/74 (77%) Frame = +3 Query: 417 MWPGGTFSFEVKEVLHTEKSKYQNIQVFDTTSLGKVLVLDGIIQCTQKDEFSYQEMISFL 596 MWPG S +V++VL +KS +Q + VF++ + GKVLVLDGI+Q T+KDE +YQEMI+ L Sbjct: 77 MWPGEAHSLKVEKVLFKDKSDFQEVLVFESATYGKVLVLDGIVQLTEKDECAYQEMIAHL 136 Query: 597 PLCCHKNPENVLIV 638 PLC +P+NVL+V Sbjct: 137 PLCSISSPKNVLVV 150 >At5g53120.2 68418.m06602 spermidine synthase, putative / putrescine aminopropyltransferase, putative similar to SP|O82147 Spermidine synthase (EC 2.5.1.16) (Putrescine aminopropyltransferase) (SPDSY) {Coffea arabica}; contains Pfam profile PF01564: Spermine/spermidine synthase Length = 359 Score = 93.9 bits (223), Expect = 8e-20 Identities = 41/74 (55%), Positives = 57/74 (77%) Frame = +3 Query: 417 MWPGGTFSFEVKEVLHTEKSKYQNIQVFDTTSLGKVLVLDGIIQCTQKDEFSYQEMISFL 596 MWPG S +V++VL +KS +Q + VF++ + GKVLVLDGI+Q T+KDE +YQEMI+ L Sbjct: 77 MWPGEAHSLKVEKVLFKDKSDFQEVLVFESATYGKVLVLDGIVQLTEKDECAYQEMIAHL 136 Query: 597 PLCCHKNPENVLIV 638 PLC +P+NVL+V Sbjct: 137 PLCSISSPKNVLVV 150 >At5g53120.1 68418.m06601 spermidine synthase, putative / putrescine aminopropyltransferase, putative similar to SP|O82147 Spermidine synthase (EC 2.5.1.16) (Putrescine aminopropyltransferase) (SPDSY) {Coffea arabica}; contains Pfam profile PF01564: Spermine/spermidine synthase Length = 359 Score = 93.9 bits (223), Expect = 8e-20 Identities = 41/74 (55%), Positives = 57/74 (77%) Frame = +3 Query: 417 MWPGGTFSFEVKEVLHTEKSKYQNIQVFDTTSLGKVLVLDGIIQCTQKDEFSYQEMISFL 596 MWPG S +V++VL +KS +Q + VF++ + GKVLVLDGI+Q T+KDE +YQEMI+ L Sbjct: 77 MWPGEAHSLKVEKVLFKDKSDFQEVLVFESATYGKVLVLDGIVQLTEKDECAYQEMIAHL 136 Query: 597 PLCCHKNPENVLIV 638 PLC +P+NVL+V Sbjct: 137 PLCSISSPKNVLVV 150 >At5g19530.1 68418.m02326 spermine/spermidine synthase family protein similar to SP|P09158 Spermidine synthase (EC 2.5.1.16) (Putrescine aminopropyltransferase) {Escherichia coli}; contains Pfam profile PF01564: Spermine/spermidine synthase Length = 339 Score = 66.1 bits (154), Expect = 2e-11 Identities = 33/82 (40%), Positives = 48/82 (58%) Frame = +3 Query: 393 NWFTESCDMWPGGTFSFEVKEVLHTEKSKYQNIQVFDTTSLGKVLVLDGIIQCTQKDEFS 572 +W+ E+ D +SF + VLH S+YQ+I + DT GKVLV+DG +Q ++DEF Sbjct: 34 HWYEETID--DDLKWSFALNSVLHQGTSEYQDIALLDTKRFGKVLVIDGKMQSAERDEFI 91 Query: 573 YQEMISFLPLCCHKNPENVLIV 638 Y E + L H NP+ V I+ Sbjct: 92 YHECLIHPALLFHPNPKTVFIM 113 >At2g04920.1 68415.m00513 F-box family protein (FBX9) identical to F-box protein family, AtFBX9 (GI:20197985) [Arabidopsis thaliana]; contains F-box domain PF:00646; contains TIGRFAM TIGR01640 : F-box protein interaction domain Length = 376 Score = 31.1 bits (67), Expect = 0.65 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +3 Query: 438 SFEVKEVLHTEKSKYQNIQVFDTTSLGKVLVLDGIIQCTQKD 563 S E K VL + S Y + QV+ + KV DG++ CT KD Sbjct: 75 SIEFKSVLSLKDSHYNSEQVY----IAKVFHCDGLLLCTTKD 112 >At4g14580.1 68417.m02244 CBL-interacting protein kinase 4 (CIPK4) identical to CBL-interacting protein kinase 4 [Arabidopsis thaliana] gi|13249503|gb|AAG01367; identical to cDNA calcineurin B-like (CBL) interacting protein kinase 4 (CIPK4) GI:13249502 Length = 426 Score = 30.3 bits (65), Expect = 1.1 Identities = 18/67 (26%), Positives = 29/67 (43%) Frame = +3 Query: 390 TNWFTESCDMWPGGTFSFEVKEVLHTEKSKYQNIQVFDTTSLGKVLVLDGIIQCTQKDEF 569 T WF +S ++ + FE+ L E I FD SL L L G+ + ++ E Sbjct: 274 TVWFQKSLEISEFQSSVFELDRFLEKEAKSSNAITAFDLISLSSGLDLSGLFERRKRKEK 333 Query: 570 SYQEMIS 590 + +S Sbjct: 334 RFTARVS 340 >At4g11800.1 68417.m01879 calcineurin-like phosphoesterase family protein contains Pfam profile: PF00149 calcineurin-like phosphoesterase Length = 1012 Score = 29.1 bits (62), Expect = 2.6 Identities = 17/68 (25%), Positives = 29/68 (42%) Frame = +3 Query: 396 WFTESCDMWPGGTFSFEVKEVLHTEKSKYQNIQVFDTTSLGKVLVLDGIIQCTQKDEFSY 575 WF D GG S+ V ++L + F + G VL++ G + F+Y Sbjct: 369 WFDFMADTGDGGNSSYSVAKLLAQPSLRVPVANNFISLPRGNVLLIGGDLAYPNPSSFTY 428 Query: 576 QEMISFLP 599 ++ + F P Sbjct: 429 EKRL-FCP 435 >At3g04350.1 68416.m00460 expressed protein Length = 567 Score = 29.1 bits (62), Expect = 2.6 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -2 Query: 560 FLSALYDSVQDKNLPQTGCIKNLD 489 F YD ++ +P GC+KNLD Sbjct: 227 FFCCTYDLSSERTVPDIGCLKNLD 250 >At5g20570.1 68418.m02442 ring-box protein-related similar to ring-box protein 1 GI:4769004 from [Homo sapiens] Length = 118 Score = 28.7 bits (61), Expect = 3.4 Identities = 16/60 (26%), Positives = 29/60 (48%) Frame = +3 Query: 6 CRNRHEDICVQCQLSTVKFYI*FLSVRDKGINHKKYIYLPIGRYLGSRFVICIESYLWTY 185 CRN D+C++CQ + +V NH + + I R+L +R V +++ W + Sbjct: 55 CRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHC-ISRWLKTRQVCPLDNSEWEF 113 >At5g11300.1 68418.m01319 cyclin, putative (CYC3b) similar to cyclin 3a [Arabidopsis thaliana] GI:509425; contains Pfam profiles PF00134: Cyclin, N-terminal domain, PF02984: Cyclin, C-terminal domain; identical to cDNA cyc3b mRNA for cyclin 3b protein GI:728520 Length = 436 Score = 28.3 bits (60), Expect = 4.5 Identities = 28/112 (25%), Positives = 48/112 (42%), Gaps = 4/112 (3%) Frame = +2 Query: 101 PQKIYLSTN---RSLSRVSVCHMYRIISLDIYIVIVKCEFSNVEFVRRAKRVFIFRARNT 271 P +YL+ N R LS S R+ L + +++ ++ E F F NT Sbjct: 224 PDTLYLTVNLIDRFLSN-SYIERQRLQLLGVSCMLIASKYE--ELSAPGVEEFCFITANT 280 Query: 272 LFEREIVKTET*CQNLFNFRLQLPTWY*LLKQ-EKDGQTKNQLVYGIMRYVA 424 E++ E N +FRL +PT L++ K Q ++ + + Y+A Sbjct: 281 YTRPEVLSMEIQILNFVHFRLSVPTTKTFLRRFIKAAQASYKVPFIELEYLA 332 >At1g14460.1 68414.m01715 DNA polymerase-related weak similarity to DNA polymerase III holoenzyme tau subunit [Thermus thermophilus] GI:2583049 Length = 1116 Score = 27.9 bits (59), Expect = 6.0 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = -1 Query: 297 VFTISRSNNVFLARNIKTRFALLTNSTLLNSHFT 196 V +I+ S + L RN++ R LL+ + LLNS T Sbjct: 925 VSSITNSIEMVLRRNVEVRIILLSETELLNSKQT 958 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,729,589 Number of Sequences: 28952 Number of extensions: 278210 Number of successful extensions: 622 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 604 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 622 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1314848736 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -