BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0824 (590 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_02_0018 - 8595479-8595678,8595782-8595935,8596396-8597032,859... 30 1.6 05_07_0328 + 29286109-29286120,29286982-29287146,29288427-292885... 29 2.8 03_02_0790 - 11212540-11212698,11212777-11212873,11212974-112130... 29 2.8 01_06_0115 + 26585481-26586401,26586501-26586556,26586747-265868... 28 6.4 06_01_0730 + 5370575-5370761,5371395-5371438,5372057-5372204,537... 27 8.5 >04_02_0018 - 8595479-8595678,8595782-8595935,8596396-8597032, 8597126-8597217 Length = 360 Score = 29.9 bits (64), Expect = 1.6 Identities = 20/60 (33%), Positives = 28/60 (46%) Frame = +1 Query: 142 GGRAPLG*TSASAILCEHPR*NYTQICTNY*KTYKNQFRWEGWFHITSGRYNRPICSGSR 321 G R +G +AS + CEH R + C TY F W+G IT G Y+ + + R Sbjct: 89 GDRVGVGCIAASCLDCEHCRRSEENYCDKVALTYNGIF-WDG--SITYGGYSGMLVAHKR 145 >05_07_0328 + 29286109-29286120,29286982-29287146,29288427-29288589, 29288625-29288903,29289047-29289122,29289725-29289787, 29292116-29292164,29292413-29292504,29293017-29293068, 29293209-29293271,29293382-29293431,29293941-29294016, 29294444-29294656,29294763-29294869,29294966-29295074, 29295489-29295689,29295773-29296033,29296154-29296171, 29296287-29296397,29296755-29297030,29297108-29297382, 29297814-29298165,29298371-29298655,29298715-29299261, 29301658-29301781,29301871-29301946,29302062-29302136, 29302300-29302353,29302833-29302892,29302977-29303093, 29303228-29303361,29303480-29303682,29303879-29303976, 29304358-29304461,29304537-29304702,29304803-29304925, 29305047-29305129,29305217-29305358,29305523-29305549, 29305784-29305854,29305930-29306518 Length = 2046 Score = 29.1 bits (62), Expect = 2.8 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 3/58 (5%) Frame = +2 Query: 293 TTDQFVVGVER-KFLFIQWDGEDGSKVAVLKELGEVDK--DRPNNRINDGKADPRGRL 457 T D + ER KF +QWDGE + + +G+V RP + G DP RL Sbjct: 272 TQDFLFIATERYKFCVLQWDGEKSE--LLTRAMGDVSDRIGRPTDNGQIGIIDPDCRL 327 Score = 28.3 bits (60), Expect = 4.8 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +2 Query: 359 GSKVAVLKELGEVDKDRPNNRIN 427 G KVA K+L DKDRP+++ N Sbjct: 8 GGKVAEPKDLAATDKDRPSSKKN 30 >03_02_0790 - 11212540-11212698,11212777-11212873,11212974-11213030, 11213291-11213379,11213463-11213549,11213820-11213935, 11214026-11214281,11214361-11214510,11214948-11215106, 11215456-11215493,11215972-11216063,11216528-11216682, 11217185-11217253 Length = 507 Score = 29.1 bits (62), Expect = 2.8 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = +3 Query: 399 TKTDLITGLMMAKQILVGGCLLELWVMKILQVTLRETKPLFTNWIQL 539 TKT L ++ L GCL ++ K+ ++T + P +T+WI + Sbjct: 358 TKTKLYIKALIVSIALTAGCLWYEYIYKLDKITYNKYHP-YTSWIPI 403 >01_06_0115 + 26585481-26586401,26586501-26586556,26586747-26586876, 26587396-26587506,26587606-26587674,26588125-26588198, 26588446-26588581,26588702-26588795,26588901-26589000, 26589100-26589224,26589597-26589634,26589662-26589742, 26589868-26589972,26590102-26590166,26590371-26590572, 26591073-26591159,26591238-26591294,26591369-26591458, 26591572-26591658,26592204-26592278,26592363-26592463, 26592565-26592655 Length = 964 Score = 27.9 bits (59), Expect = 6.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 282 GNMKPTLPSKLVFVCFSVVGTYL 214 G K + P K+ +CF + GTYL Sbjct: 427 GRWKSSKPDKVAVICFGMEGTYL 449 >06_01_0730 + 5370575-5370761,5371395-5371438,5372057-5372204, 5372289-5372397,5373349-5373863,5374571-5374808, 5375296-5375560,5375740-5375844,5375950-5376015, 5376562-5377020,5377267-5377464,5378149-5378211 Length = 798 Score = 27.5 bits (58), Expect = 8.5 Identities = 20/59 (33%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Frame = +2 Query: 356 DGSKVAVLKELGEVDKDRPNNRINDGKADPRGRLFA-GTMGHEDPPGNFERNKASLYKL 529 +G +V LG V D P ++ L A T GHEDP N+A LY+L Sbjct: 465 NGEEVENDDGLGLVQSDTPLAPVDGQNMQSASNLTAFSTYGHEDP-NMHPSNEAQLYRL 522 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,943,693 Number of Sequences: 37544 Number of extensions: 326815 Number of successful extensions: 746 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 728 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 746 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1400060088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -