BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0823 (582 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC7D4.05 |||hydrolase |Schizosaccharomyces pombe|chr 1|||Manual 48 1e-06 SPBC1773.07c |sbp1|yrb1|Ran GTPase binding protein Sbp1|Schizosa... 28 0.87 >SPAC7D4.05 |||hydrolase |Schizosaccharomyces pombe|chr 1|||Manual Length = 225 Score = 47.6 bits (108), Expect = 1e-06 Identities = 37/152 (24%), Positives = 67/152 (44%), Gaps = 2/152 (1%) Frame = +1 Query: 127 LQGIRLVTFDATNTLLKFKMVPSQYYTKIARTYGYRGSESDAQNKMRENFKMMWEQHPNF 306 +Q I+LVTFDA T+L Y+++A+ YG + + ++ FK E+H N Sbjct: 7 IQKIKLVTFDAFGTILHLSKPVPIVYSEVAQKYGVHATIDEIEH---NTFKDFSEKHKNH 63 Query: 307 GRNSIL-WEEWWRQVVKLTLQDHLPVGADTRSLGNTLINDFKTSKCWDV-AAGSDTLLQX 480 G+ S L +WW +V++ + +P + L + F + + D L + Sbjct: 64 GKKSGLNPHDWWIKVIEHSFPTPVPA-----EMAEELWSYFSKKTGYTIHPLLIDFLKRN 118 Query: 481 XXXXXXXXXXXSNSDPRLYDILQNLGLSKYFD 576 SN+D R+ +L++ G+ D Sbjct: 119 KEERKYIIGIISNTDERIRTVLEDYGIDHLID 150 >SPBC1773.07c |sbp1|yrb1|Ran GTPase binding protein Sbp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 215 Score = 28.3 bits (60), Expect = 0.87 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +2 Query: 179 SKWYPRNITQ-RLHVHMVTGEAKVMLKIR*GKTLK*CGNSILILEGILSSGKNGGDKW 349 S+W R RL H TG+ ++++ R KTLK C N +L+ E L+ W Sbjct: 111 SEWKERGTGDARLLKHKETGKTRLVM--RRDKTLKVCANHLLMPEMKLTPNVGSDRSW 166 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,309,893 Number of Sequences: 5004 Number of extensions: 45922 Number of successful extensions: 87 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 86 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 87 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 250133048 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -