BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0823 (582 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g14310.1 68414.m01696 haloacid dehalogenase-like hydrolase fa... 36 0.026 At2g41250.1 68415.m05094 haloacid dehalogenase-like hydrolase fa... 33 0.11 At4g20200.1 68417.m02953 terpene synthase/cyclase family protein... 29 2.3 At2g31820.1 68415.m03886 ankyrin repeat family protein contains ... 29 3.0 At5g58590.1 68418.m07342 Ran-binding protein 1, putative / RanBP... 28 4.0 At4g01210.1 68417.m00159 glycosyltransferase family protein 1 co... 28 5.2 At3g11160.1 68416.m01353 expressed protein 28 5.2 At3g48250.1 68416.m05266 pentatricopeptide (PPR) repeat-containi... 27 6.9 At2g30060.1 68415.m03656 Ran-binding protein 1b (RanBP1b) nearly... 27 6.9 At2g24690.1 68415.m02948 transcriptional factor B3 family protei... 27 6.9 At4g33280.1 68417.m04735 transcriptional factor B3 family protei... 27 9.1 At4g03440.1 68417.m00471 ankyrin repeat family protein contains ... 27 9.1 At1g05640.1 68414.m00585 ankyrin repeat family protein contains ... 27 9.1 >At1g14310.1 68414.m01696 haloacid dehalogenase-like hydrolase family protein contains InterPro accession IPR005834: Haloacid dehalogenase-like hydrolase Length = 254 Score = 35.5 bits (78), Expect = 0.026 Identities = 29/160 (18%), Positives = 58/160 (36%) Frame = +1 Query: 103 TSNPLEMCLQGIRLVTFDATNTLLKFKMVPSQYYTKIARTYGYRGSESDAQNKMRENFKM 282 T P++ G+ L DA TLL+ + Y + + YG + + ++ + + F Sbjct: 34 TGKPIKRAYDGLLL---DAGGTLLQLSKPVHETYASLGQKYGLKTTPAEIKEGFKRVFSA 90 Query: 283 MWEQHPNFGRNSILWEEWWRQVVKLTLQDHLPVGADTRSLGNTLINDFKTSKCWDVAAGS 462 W + + + +W+ VV G + + + W + G+ Sbjct: 91 PWPEKLRYQGDG---RPFWKLVVSEA------TGCSDNDYFEDVYQYYANGEAWHLPEGA 141 Query: 463 DTLLQXXXXXXXXXXXXSNSDPRLYDILQNLGLSKYFDFI 582 + SN D RL +L++L + FD + Sbjct: 142 YETMSLLKDAGVKMAVVSNFDTRLRKLLKDLNVIDMFDAV 181 >At2g41250.1 68415.m05094 haloacid dehalogenase-like hydrolase family protein low similarity to SP|Q94915 Rhythmically expressed gene 2 protein (DREG-2) {Drosophila melanogaster}; contains InterPro accession IPR005834: Haloacid dehalogenase-like hydrolase Length = 290 Score = 33.5 bits (73), Expect = 0.11 Identities = 31/145 (21%), Positives = 54/145 (37%), Gaps = 2/145 (1%) Frame = +1 Query: 154 DATNTLLKFKMVPSQYYTKIARTYGYRGSESDAQNKMRENFKMMW-EQHPNFGRNSILWE 330 DA TLL +Q Y I YG SE++ + R ++ W H + ++ Sbjct: 83 DAVGTLLVPAQPTAQIYKNIGEKYGVEYSEAEILTRYRRAYQKPWGGSHLRYVNDA---R 139 Query: 331 EWWRQVVKLTLQDHLPVGADTRSLGNTLINDFKTSKCWDVA-AGSDTLLQXXXXXXXXXX 507 +W+ +V + G L + F T + W + + + + Sbjct: 140 PFWQYIVTAS------TGCSDSQYFEELYSYFTTEQAWKLCDPDAGKVFKAIKEAGVKVA 193 Query: 508 XXSNSDPRLYDILQNLGLSKYFDFI 582 SN D RL +L+ L +FD + Sbjct: 194 IVSNFDTRLRPLLRALRCEDWFDAV 218 >At4g20200.1 68417.m02953 terpene synthase/cyclase family protein 5-epi-aristolochene synthase, Nicotiana tabacum, PATX:G505588 Length = 604 Score = 29.1 bits (62), Expect = 2.3 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = +1 Query: 106 SNPLE-MCLQGIRLVTFDATNTLLKFKMVPSQYYTKIARTYGYRGSESDAQNK 261 S PL+ + L+ +TFD + KFK +P+ +T + SE DA K Sbjct: 39 SKPLKHIRLKATNTLTFDDQERIRKFKKLPTSEWTHYGHSISIDVSEMDALRK 91 >At2g31820.1 68415.m03886 ankyrin repeat family protein contains ankyrin repeat domains, Pfam:PF00023 Length = 662 Score = 28.7 bits (61), Expect = 3.0 Identities = 18/37 (48%), Positives = 21/37 (56%) Frame = -2 Query: 455 AATSQHLEVLKSLIKVFPKLLVSAPTGR*SCKVSLTT 345 AA HLEVLK L++ FP L A T SC +L T Sbjct: 231 AAKQGHLEVLKILLETFPNL---AMTTDLSCTTALHT 264 >At5g58590.1 68418.m07342 Ran-binding protein 1, putative / RanBP1, putative strong similarity to Ran binding proteins from Arabidopsis thaliana atranbp1a [Arabidopsis thaliana] GI:2058282, atranbp1b [Arabidopsis thaliana] GI:2058284; contains Pfam profile PF00638: RanBP1 domain Length = 219 Score = 28.3 bits (60), Expect = 4.0 Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = +2 Query: 179 SKWYPRNI-TQRLHVHMVTGEAKVMLKIR*GKTLK*CGNSILILEGILSSGKNGGDK 346 ++W R T +L H TG KV L +R KTLK C N LI G+ +G +K Sbjct: 63 NQWKERGAGTVKLLKHKETG--KVRLVMRQSKTLKICANH-LISSGMSVQEHSGNEK 116 >At4g01210.1 68417.m00159 glycosyltransferase family protein 1 contains Pfam profile: PF00534 Glycosyl transferases group 1 Length = 981 Score = 27.9 bits (59), Expect = 5.2 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +1 Query: 280 MMWEQHPNFGRNSILWEEWWRQVVKLTLQDHLPVGADT-RSLGNTL 414 +M EQH R +W +W+ T+ + L AD+ R +G+ L Sbjct: 863 LMQEQHKQKNRRGKMWVKWFDYTTLKTMDEDLAEEADSDRRVGHWL 908 >At3g11160.1 68416.m01353 expressed protein Length = 145 Score = 27.9 bits (59), Expect = 5.2 Identities = 21/62 (33%), Positives = 27/62 (43%), Gaps = 1/62 (1%) Frame = +1 Query: 172 LKFKMVPSQYYTKIARTYGYRGSESDAQNKMRENFKMMWEQHPNFGRNSILWEE-WWRQV 348 L+ KM P + R SESD + KM +WE R+S LWEE W + Sbjct: 70 LRKKMWPELKDKEWFRITSRMWSESDIRKKMLRMRSDLWES-MGVSRSSDLWEEKMWDYL 128 Query: 349 VK 354 K Sbjct: 129 TK 130 >At3g48250.1 68416.m05266 pentatricopeptide (PPR) repeat-containing protein vacontains Pfam profile PF01535: PPR repeat Length = 621 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = -1 Query: 348 HLSPPFFPEDRIPSKIRMLF--PHHFKVFPHL 259 H+ F+ E R+ +LF PHHFK P + Sbjct: 582 HVIEAFYREGRLTDAKNLLFICPHHFKTHPKI 613 >At2g30060.1 68415.m03656 Ran-binding protein 1b (RanBP1b) nearly identical to atranbp1b [Arabidopsis thaliana] GI:2058284 Length = 217 Score = 27.5 bits (58), Expect = 6.9 Identities = 21/57 (36%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Frame = +2 Query: 179 SKWYPRNI-TQRLHVHMVTGEAKVMLKIR*GKTLK*CGNSILILEGILSSGKNGGDK 346 S+W R T + H V+G K+ L +R KTLK C N L+ G+ G DK Sbjct: 66 SQWKERGAGTVKFLKHRVSG--KIRLVMRQSKTLKICANH-LVGSGMSVQEHAGNDK 119 >At2g24690.1 68415.m02948 transcriptional factor B3 family protein low similarity to reproductive meristem protein 1 [Arabidopsis thaliana] GI:13604227; contains Pfam profile PF02362: B3 DNA binding domain Length = 682 Score = 27.5 bits (58), Expect = 6.9 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 453 GWKRYIAANNKKEGDSY 503 GWK ++ AN K GD+Y Sbjct: 92 GWKSFVKANGLKTGDTY 108 >At4g33280.1 68417.m04735 transcriptional factor B3 family protein contains Pfam profile PF02362: B3 DNA binding domain Length = 461 Score = 27.1 bits (57), Expect = 9.1 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +3 Query: 450 SGWKRYIAANNKKEGD 497 +GWK+++ NN +EGD Sbjct: 406 TGWKKFVQDNNLREGD 421 >At4g03440.1 68417.m00471 ankyrin repeat family protein contains ankyrin repeats, Pfam domain PF00023 Length = 751 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -2 Query: 455 AATSQHLEVLKSLIKVFPKLLV 390 AA HLE++KS++ FP LL+ Sbjct: 132 AAAFGHLELVKSIVSKFPSLLL 153 >At1g05640.1 68414.m00585 ankyrin repeat family protein contains ankyrin repeat domains, Pfam:PF00023 Length = 627 Score = 27.1 bits (57), Expect = 9.1 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -2 Query: 455 AATSQHLEVLKSLIKVFPKLLVSAPTGR*SCKVSLTT 345 AA H+E LK L++ FP L ++ SC +L T Sbjct: 195 AAKQGHIEALKKLLETFPNLAMTVDL---SCTTALHT 228 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,984,896 Number of Sequences: 28952 Number of extensions: 240776 Number of successful extensions: 570 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 553 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 570 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1141585696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -