BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0819 (568 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z98853-7|CAB57906.1| 1675|Caenorhabditis elegans Hypothetical pr... 28 5.4 Z75530-10|CAA99796.2| 1675|Caenorhabditis elegans Hypothetical p... 28 5.4 >Z98853-7|CAB57906.1| 1675|Caenorhabditis elegans Hypothetical protein C47E8.8 protein. Length = 1675 Score = 27.9 bits (59), Expect = 5.4 Identities = 18/61 (29%), Positives = 33/61 (54%), Gaps = 3/61 (4%) Frame = -2 Query: 201 EKNENHL--KFKVVTLKKKNTILYKINR-DRIV*F*HHTLYRVQSYNINDIINLWLQLTL 31 E++E H+ KF+++ LKK NT + R DRI+ + + S N+ +++ +T Sbjct: 80 ERDEVHITPKFRIILLKKTNTNSTNVRRNDRIIMNPKNKSSTIISKNVEELLPTLFPITE 139 Query: 30 V 28 V Sbjct: 140 V 140 >Z75530-10|CAA99796.2| 1675|Caenorhabditis elegans Hypothetical protein C47E8.8 protein. Length = 1675 Score = 27.9 bits (59), Expect = 5.4 Identities = 18/61 (29%), Positives = 33/61 (54%), Gaps = 3/61 (4%) Frame = -2 Query: 201 EKNENHL--KFKVVTLKKKNTILYKINR-DRIV*F*HHTLYRVQSYNINDIINLWLQLTL 31 E++E H+ KF+++ LKK NT + R DRI+ + + S N+ +++ +T Sbjct: 80 ERDEVHITPKFRIILLKKTNTNSTNVRRNDRIIMNPKNKSSTIISKNVEELLPTLFPITE 139 Query: 30 V 28 V Sbjct: 140 V 140 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,769,580 Number of Sequences: 27780 Number of extensions: 153205 Number of successful extensions: 278 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 277 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 278 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1176726318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -