BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0818 (501 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0045 - 25393185-25394431,25394837-25395166,25395450-25396386 29 2.8 06_03_0870 + 25557988-25558309,25558798-25559011,25559110-255593... 27 8.5 >02_05_0045 - 25393185-25394431,25394837-25395166,25395450-25396386 Length = 837 Score = 28.7 bits (61), Expect = 2.8 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = -1 Query: 264 GFCFSTMDG--APTTGDCVGSPSSMIRLSASIR 172 G+C S DG PT G C G I+LS +R Sbjct: 160 GYCVSRCDGEKVPTEGPCNGKGCCSIKLSRDLR 192 >06_03_0870 + 25557988-25558309,25558798-25559011,25559110-25559342, 25559473-25559630,25559900-25560001 Length = 342 Score = 27.1 bits (57), Expect = 8.5 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = -3 Query: 385 SFRFFVSPPITPRSFYKRRHNFTFGIRASPFLFDVSVNASRF 260 SFR FV P P +FY+ T G AS F ++ SRF Sbjct: 4 SFRVFVYPDGDPGTFYQTPRKLT-GKYASEGYFFQNIRESRF 44 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,335,242 Number of Sequences: 37544 Number of extensions: 193047 Number of successful extensions: 363 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 360 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 363 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1059318940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -