BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0818 (501 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44095| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.31 SB_23485| Best HMM Match : PsbJ (HMM E-Value=2.4) 29 2.2 >SB_44095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3051 Score = 31.9 bits (69), Expect = 0.31 Identities = 16/48 (33%), Positives = 21/48 (43%) Frame = +1 Query: 67 VGSTEVFGHINQCTIRIDCSSIINRKEGIIDQLLFPNGRG*SYHRRWR 210 +G E+ IN C DC S + EG I+ +P G S WR Sbjct: 888 LGDAEIQNLINMCNYSQDCGSTLRASEGTINSPNWPQGYKGSKTCTWR 935 >SB_23485| Best HMM Match : PsbJ (HMM E-Value=2.4) Length = 497 Score = 29.1 bits (62), Expect = 2.2 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 364 PPITPRSFYKRRHNFTFGIRASP-FLFDVSVNASRFLFFND 245 PPITP +F++ + GI S F F + ASR L +D Sbjct: 48 PPITPNAFWEWSVSLLTGILVSSLFYFTLETRASRLLASSD 88 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,316,341 Number of Sequences: 59808 Number of extensions: 226175 Number of successful extensions: 400 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 378 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 400 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1087245449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -