BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0818 (501 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein p... 23 4.4 AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 23 5.8 AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein p... 23 7.7 >AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein protein. Length = 353 Score = 23.4 bits (48), Expect = 4.4 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -1 Query: 258 CFSTMDGAPTTGDCVGSPSSMIRL 187 CF ++ TT DC G S + L Sbjct: 291 CFRCLERGHTTADCAGEDRSSLCL 314 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 23.0 bits (47), Expect = 5.8 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +3 Query: 9 IRHEVAVEKRVLRDKKNSY 65 + H++ VEK + R+KK+ Y Sbjct: 1448 VSHDLTVEKELDREKKSLY 1466 >AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein protein. Length = 527 Score = 22.6 bits (46), Expect = 7.7 Identities = 8/37 (21%), Positives = 20/37 (54%) Frame = +3 Query: 207 ANRRNHQWSGRHPSLKNRNRLALTETSKRKGDARIPN 317 A+R++ QW + + + R+ + + KR+ + P+ Sbjct: 269 AHRQHQQWPHQQNGQQQQQRMGIHQQEKRRPRRKRPD 305 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 450,366 Number of Sequences: 2352 Number of extensions: 7561 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44823054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -