BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0818 (501 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g27870.1 68414.m03415 hypothetical protein 29 2.3 At1g59865.1 68414.m06743 expressed protein 27 5.4 >At1g27870.1 68414.m03415 hypothetical protein Length = 213 Score = 28.7 bits (61), Expect = 2.3 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -3 Query: 292 LFDVSVNASRFLFFNDGWRPD-HW*LRRFAIFYDKIIRVH*ETIID 158 LFD+ +N S+ F W D HW LR+F + IR H T D Sbjct: 134 LFDL-INGSKVYFGVHNWIRDIHWWLRKFESIHFNWIRRHHNTPAD 178 >At1g59865.1 68414.m06743 expressed protein Length = 175 Score = 27.5 bits (58), Expect = 5.4 Identities = 14/50 (28%), Positives = 26/50 (52%) Frame = -1 Query: 150 TFFSVNYRRTINTNSTLIYMTKNFS*TNSMNFFYHEVLFSRPLPRAEFLQ 1 TFF+ + ++ + TL Y + FS ++S++ F+ S P +F Q Sbjct: 56 TFFASTFMLPVSASPTLSYKSSLFS-SSSLSVFFIHASSSSHFPEVDFQQ 104 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,435,773 Number of Sequences: 28952 Number of extensions: 163763 Number of successful extensions: 316 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 313 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 316 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 888318720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -