BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0814 (592 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58699| Best HMM Match : UCR_14kD (HMM E-Value=3.6e-37) 94 9e-20 SB_3002| Best HMM Match : Pkinase (HMM E-Value=4.1e-17) 31 0.70 SB_54614| Best HMM Match : Peptidase_A17 (HMM E-Value=1.2e-38) 29 2.1 SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) 29 2.1 SB_36418| Best HMM Match : Ion_trans (HMM E-Value=3.5e-28) 29 3.8 SB_38133| Best HMM Match : TolA (HMM E-Value=0.38) 28 5.0 SB_44511| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_28600| Best HMM Match : EGF_CA (HMM E-Value=4.2e-40) 27 8.7 SB_22055| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_28421| Best HMM Match : Oxysterol_BP (HMM E-Value=4.5e-11) 27 8.7 >SB_58699| Best HMM Match : UCR_14kD (HMM E-Value=3.6e-37) Length = 116 Score = 93.9 bits (223), Expect = 9e-20 Identities = 44/98 (44%), Positives = 63/98 (64%) Frame = -1 Query: 400 SDSLSKWAYNLSGFNKYGLLRDDCLHETPDVTEALRRLPSHVVDERNFRIVRAIQLSMQK 221 S + +W G+ + GL R+D + E DV EA+RR+P + RNFRIVRAI +M+ Sbjct: 19 SAAFREWYIYACGYRQIGLKREDLIIEDSDVAEAVRRIPEEERNLRNFRIVRAIDTTMKM 78 Query: 220 TILPKEEWTKYEEDSLYLTPIVEQVEKERLEREQWEKE 107 LP+E WTK ED YL P++++V+ ER ERE W+K+ Sbjct: 79 KWLPEELWTKPSEDVPYLDPVIQKVKAERKERELWDKQ 116 >SB_3002| Best HMM Match : Pkinase (HMM E-Value=4.1e-17) Length = 683 Score = 31.1 bits (67), Expect = 0.70 Identities = 16/54 (29%), Positives = 29/54 (53%) Frame = -1 Query: 346 LLRDDCLHETPDVTEALRRLPSHVVDERNFRIVRAIQLSMQKTILPKEEWTKYE 185 LL + LH+ PD +AL + + + + FRI +A+ S +K I + + Y+ Sbjct: 343 LLAEPALHKDPDTIKALWKATVNELGDLEFRIQQAMTSSSKKPIAEEYSFLVYD 396 >SB_54614| Best HMM Match : Peptidase_A17 (HMM E-Value=1.2e-38) Length = 1935 Score = 29.5 bits (63), Expect = 2.1 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 3/56 (5%) Frame = -1 Query: 337 DDCLHETPDVTEALRRLPS--HVVDERNFRIVRAIQLSMQ-KTILPKEEWTKYEED 179 DDCLH TP EA+R ++ FR+ + + S + + LP+ E T +D Sbjct: 1166 DDCLHSTPTEAEAVRLATDLRELLARGGFRLTKFVSNSKELLSSLPESERTTSVKD 1221 >SB_19540| Best HMM Match : Pro_isomerase (HMM E-Value=1.5e-23) Length = 741 Score = 29.5 bits (63), Expect = 2.1 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = -1 Query: 235 LSMQKTILPKEEWTKYEEDSLYLTPIVEQVEKERLERE-QWEKEY 104 LS + T P + T E+D L L + Q EK+ ER+ +W + Y Sbjct: 102 LSSEPTQQPTKPLTVQEQDDLALAQALAQSEKDEAERKRRWGESY 146 >SB_36418| Best HMM Match : Ion_trans (HMM E-Value=3.5e-28) Length = 466 Score = 28.7 bits (61), Expect = 3.8 Identities = 16/38 (42%), Positives = 23/38 (60%) Frame = -1 Query: 235 LSMQKTILPKEEWTKYEEDSLYLTPIVEQVEKERLERE 122 LS KT LPKE+W K E++S P V Q ++ +R+ Sbjct: 8 LSPPKT-LPKEQWAKREKNSEGFKPGVMQEKRTLFKRD 44 >SB_38133| Best HMM Match : TolA (HMM E-Value=0.38) Length = 2114 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/45 (31%), Positives = 27/45 (60%) Frame = -1 Query: 241 IQLSMQKTILPKEEWTKYEEDSLYLTPIVEQVEKERLEREQWEKE 107 I+ S+QKT PK++ + E+D E+ EK++ ++E E++ Sbjct: 1868 IEKSLQKTFHPKKKENEEEDDKKEKKEENEEEEKKKKKKENEEED 1912 >SB_44511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 51 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/42 (33%), Positives = 25/42 (59%) Frame = -1 Query: 232 SMQKTILPKEEWTKYEEDSLYLTPIVEQVEKERLEREQWEKE 107 S + +L ++E K EE + LTP ++ +LE+++ EKE Sbjct: 8 SNEHLLLNEKEPPKKEEPKIVLTPEEQEELDRKLEKQRMEKE 49 >SB_28600| Best HMM Match : EGF_CA (HMM E-Value=4.2e-40) Length = 1042 Score = 27.5 bits (58), Expect = 8.7 Identities = 15/51 (29%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = +2 Query: 383 FAEAVTSVNSRGSESHHGSCSKSHFIDSQIYDFNVILTQTTRSK-TNLLVM 532 F + V + S HHGSC +H+ I+ I+ + + TNL V+ Sbjct: 240 FKKHVCRIKGNFSYLHHGSCRGTHYAFFLIFPLRAIMRIRLQDRITNLEVL 290 >SB_22055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 377 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 496 SNNQKQNQFACDGNTHSVNQNRGHPFLEN 582 S+N QN+ +GNT + + RG FL + Sbjct: 251 SDNDPQNRITFEGNTEPLEKTRGGVFLRH 279 >SB_28421| Best HMM Match : Oxysterol_BP (HMM E-Value=4.5e-11) Length = 378 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +3 Query: 258 KFLSSTTWDGSLRSASVTSGVSCKQSSRNKP 350 +++ +WD SL +GV+C RN+P Sbjct: 223 RYVIEGSWDKSLECIPQDTGVTCPTDCRNRP 253 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,659,640 Number of Sequences: 59808 Number of extensions: 319086 Number of successful extensions: 1058 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 960 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1052 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1434459094 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -