BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0814 (592 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g32470.1 68417.m04622 ubiquinol-cytochrome C reductase comple... 56 2e-08 At5g25450.1 68418.m03023 ubiquinol-cytochrome C reductase comple... 54 5e-08 At4g32470.2 68417.m04623 ubiquinol-cytochrome C reductase comple... 49 3e-06 At1g13420.1 68414.m01566 sulfotransferase family protein similar... 31 0.57 At5g28150.1 68418.m03402 expressed protein 30 1.0 At3g48830.1 68416.m05333 polynucleotide adenylyltransferase fami... 29 2.3 At4g17220.1 68417.m02590 expressed protein 29 3.1 At2g22720.3 68415.m02692 expressed protein 28 4.1 At2g22720.2 68415.m02691 expressed protein 28 4.1 At2g22720.1 68415.m02693 expressed protein 28 4.1 At5g15450.1 68418.m01808 heat shock protein 100, putative / HSP1... 28 5.4 At1g74600.1 68414.m08641 pentatricopeptide (PPR) repeat-containi... 28 5.4 At3g60370.1 68416.m06752 immunophilin / FKBP-type peptidyl-proly... 27 7.1 At2g40360.1 68415.m04977 transducin family protein / WD-40 repea... 27 7.1 At1g21600.1 68414.m02700 expressed protein similar to hypothetic... 27 7.1 At4g30020.1 68417.m04272 subtilase family protein contains simil... 27 9.4 At2g12900.1 68415.m01408 hypothetical protein similar to transcr... 27 9.4 >At4g32470.1 68417.m04622 ubiquinol-cytochrome C reductase complex 14 kDa protein, putative similar to SP|P48502 Ubiquinol-cytochrome C reductase complex 14 kDa protein (EC 1.10.2.2) (CR14) {Solanum tuberosum}; contains Pfam profile PF02271: Ubiquinol-cytochrome C reductase complex 14kD subunit Length = 122 Score = 56.0 bits (129), Expect = 2e-08 Identities = 33/80 (41%), Positives = 45/80 (56%), Gaps = 2/80 (2%) Frame = -1 Query: 355 KYGLLRDDCLHE--TPDVTEALRRLPSHVVDERNFRIVRAIQLSMQKTILPKEEWTKYEE 182 +YGL DD + + D+ EA+ RLP VVD RN R+ RA+ LSM+ LPK+ Sbjct: 30 RYGLRYDDLYDQYYSMDIKEAMNRLPREVVDARNQRLKRAMDLSMKHEYLPKDLQAVQTP 89 Query: 181 DSLYLTPIVEQVEKERLERE 122 YL ++ VE+E ERE Sbjct: 90 FRGYLQDMLALVERESKERE 109 >At5g25450.1 68418.m03023 ubiquinol-cytochrome C reductase complex 14 kDa protein, putative similar to SP|P48502 Ubiquinol-cytochrome C reductase complex 14 kDa protein (EC 1.10.2.2) (CR14) {Solanum tuberosum}; contains Pfam profile PF02271: Ubiquinol-cytochrome C reductase complex 14kD subunit Length = 122 Score = 54.4 bits (125), Expect = 5e-08 Identities = 33/81 (40%), Positives = 46/81 (56%), Gaps = 3/81 (3%) Frame = -1 Query: 355 KYGLLRDDC---LHETPDVTEALRRLPSHVVDERNFRIVRAIQLSMQKTILPKEEWTKYE 185 +YGL DD L++ D+ EAL RLP +VD RN R++RA+ LSM+ LP Sbjct: 30 RYGLRYDDLYDPLYDL-DIKEALNRLPREIVDARNQRLMRAMDLSMKHEYLPDNLQAVQT 88 Query: 184 EDSLYLTPIVEQVEKERLERE 122 YL ++ V++ER ERE Sbjct: 89 PFRSYLQDMLALVKRERAERE 109 >At4g32470.2 68417.m04623 ubiquinol-cytochrome C reductase complex 14 kDa protein, putative similar to SP|P48502 Ubiquinol-cytochrome C reductase complex 14 kDa protein (EC 1.10.2.2) (CR14) {Solanum tuberosum}; contains Pfam profile PF02271: Ubiquinol-cytochrome C reductase complex 14kD subunit Length = 101 Score = 48.8 bits (111), Expect = 3e-06 Identities = 25/53 (47%), Positives = 34/53 (64%), Gaps = 2/53 (3%) Frame = -1 Query: 355 KYGLLRDDCLHE--TPDVTEALRRLPSHVVDERNFRIVRAIQLSMQKTILPKE 203 +YGL DD + + D+ EA+ RLP VVD RN R+ RA+ LSM+ LPK+ Sbjct: 30 RYGLRYDDLYDQYYSMDIKEAMNRLPREVVDARNQRLKRAMDLSMKHEYLPKD 82 >At1g13420.1 68414.m01566 sulfotransferase family protein similar to steroid sulfotransferase 1 GI:3420004 from (Brassica napus); contains Pfam profile PF00685: Sulfotransferase domain Length = 331 Score = 31.1 bits (67), Expect = 0.57 Identities = 21/51 (41%), Positives = 29/51 (56%) Frame = -2 Query: 303 KHSADFHPMLLTRETSVLYVPYSSPCKKQSYLKKSGQNMKKIPYT*PQLLS 151 KH++D HP LLT L VPY + YLK S ++ K+P + P+L S Sbjct: 98 KHTSDNHP-LLTHNPHEL-VPY---LELDLYLKSSKPDLTKLPSSSPRLFS 143 >At5g28150.1 68418.m03402 expressed protein Length = 289 Score = 30.3 bits (65), Expect = 1.0 Identities = 23/61 (37%), Positives = 30/61 (49%), Gaps = 3/61 (4%) Frame = +3 Query: 162 GVKYRESSSYFVHSSLGR-IVFCMESCMARTIRKFLSSTTWDGSLRSASVTSGV--SCKQ 332 GV+ +SSS + +V C+ C R R L + TW +L SVT GV SC Q Sbjct: 12 GVQVADSSSSSNSGKNAQNLVTCIYQCRIRG-RNCLITVTWTKNLMGQSVTVGVDDSCNQ 70 Query: 333 S 335 S Sbjct: 71 S 71 >At3g48830.1 68416.m05333 polynucleotide adenylyltransferase family protein / RNA recognition motif (RRM)-containing protein similar to SP|P13685 Poly(A) polymerase (EC 2.7.7.19) {Escherichia coli O157:H7}; contains Pfam profiles PF01743: polyA polymerase family protein, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 881 Score = 29.1 bits (62), Expect = 2.3 Identities = 16/49 (32%), Positives = 27/49 (55%) Frame = -1 Query: 256 RIVRAIQLSMQKTILPKEEWTKYEEDSLYLTPIVEQVEKERLEREQWEK 110 RI ++ + QK +PK++ + ED L PI+++ KE E E E+ Sbjct: 466 RIFECVKENGQKGFVPKQDSKREPEDDLETKPILKK-HKENSEEENKEQ 513 >At4g17220.1 68417.m02590 expressed protein Length = 513 Score = 28.7 bits (61), Expect = 3.1 Identities = 19/74 (25%), Positives = 33/74 (44%) Frame = -1 Query: 340 RDDCLHETPDVTEALRRLPSHVVDERNFRIVRAIQLSMQKTILPKEEWTKYEEDSLYLTP 161 ++D L EALRR+ +H D+ + + I + + K E + +ED L Sbjct: 82 KEDALAAQDAAEEALRRVYTHQQDDDSLPLESIIAPLESQIKIHKHEISALQEDKKALER 141 Query: 160 IVEQVEKERLEREQ 119 + + E LE E+ Sbjct: 142 LTKSKESALLEAER 155 >At2g22720.3 68415.m02692 expressed protein Length = 569 Score = 28.3 bits (60), Expect = 4.1 Identities = 13/46 (28%), Positives = 28/46 (60%), Gaps = 5/46 (10%) Frame = -1 Query: 229 MQKTILPKEEWTKYEEDSLYLTPIVEQVEKE-----RLEREQWEKE 107 M + +LP + +++Y++D + + E ++KE R+ RE+ E+E Sbjct: 503 MLRQLLPPKRFSRYDDDDINMEAGFEDIQKEERRSARIAREEDERE 548 >At2g22720.2 68415.m02691 expressed protein Length = 672 Score = 28.3 bits (60), Expect = 4.1 Identities = 13/46 (28%), Positives = 28/46 (60%), Gaps = 5/46 (10%) Frame = -1 Query: 229 MQKTILPKEEWTKYEEDSLYLTPIVEQVEKE-----RLEREQWEKE 107 M + +LP + +++Y++D + + E ++KE R+ RE+ E+E Sbjct: 606 MLRQLLPPKRFSRYDDDDINMEAGFEDIQKEERRSARIAREEDERE 651 >At2g22720.1 68415.m02693 expressed protein Length = 340 Score = 28.3 bits (60), Expect = 4.1 Identities = 13/46 (28%), Positives = 28/46 (60%), Gaps = 5/46 (10%) Frame = -1 Query: 229 MQKTILPKEEWTKYEEDSLYLTPIVEQVEKE-----RLEREQWEKE 107 M + +LP + +++Y++D + + E ++KE R+ RE+ E+E Sbjct: 274 MLRQLLPPKRFSRYDDDDINMEAGFEDIQKEERRSARIAREEDERE 319 >At5g15450.1 68418.m01808 heat shock protein 100, putative / HSP100, putative / heat shock protein clpB, putative / HSP100/ClpB, putative similar to HSP100/ClpB GI:9651530 [Phaseolus lunatus] Length = 968 Score = 27.9 bits (59), Expect = 5.4 Identities = 17/55 (30%), Positives = 26/55 (47%) Frame = -1 Query: 268 ERNFRIVRAIQLSMQKTILPKEEWTKYEEDSLYLTPIVEQVEKERLEREQWEKEY 104 ER RI + L +K E+W L I E++++ LE +Q E+EY Sbjct: 515 ERLNRIETELVLLKEKQAELTEQWEHERSVMSRLQSIKEEIDRVNLEIQQAEREY 569 >At1g74600.1 68414.m08641 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 895 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 382 WAYNLSGFNKYGLLRD 335 WA +SGFN+YG LR+ Sbjct: 519 WASMISGFNEYGYLRE 534 >At3g60370.1 68416.m06752 immunophilin / FKBP-type peptidyl-prolyl cis-trans isomerase family protein SP:Q9M222; similar to FKBP-type peptidyl-prolyl cis-trans isomerase fkpA precursor (PPiase) (Rotamase)(SP:Q8X880) [Escherichia coli O157:H7] ; contains Pfam PF00254: peptidyl-prolyl cis-trans isomerase, FKBP-type Length = 242 Score = 27.5 bits (58), Expect = 7.1 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = -2 Query: 258 SVLYVPYSSPCKKQSYLKKSGQNMKKIPYT*PQLLSKLRKRGWRESS 118 S++YV +SPC L S + K PY +LL + KR RE++ Sbjct: 47 SLVYVLVASPCLLLPALSSSAKTKSKSPYDERRLLEQ-NKRIQRENN 92 >At2g40360.1 68415.m04977 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to block of proliferation protein Bop1 (GI:1679772) [Mus musculus] Length = 753 Score = 27.5 bits (58), Expect = 7.1 Identities = 18/51 (35%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = -1 Query: 337 DDCLHETPDVTEALRR-LPSHVVDERNFRIVRAIQLSMQKTILPKEEWTKY 188 DD +H E RR +PS ++ +IVRAI+ K P+EE Y Sbjct: 242 DDAIHPLSSAPEPKRRFIPSKWEAKKVVKIVRAIRKGWIKFDKPEEEPNVY 292 >At1g21600.1 68414.m02700 expressed protein similar to hypothetical protein GB:AAD41412 GI:5263310 from [Arabidopsis thaliana] Length = 328 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -1 Query: 262 NFRIVRAIQLSMQKTILPKEEWTKYEED 179 +F+I+ + T++ +EEWTK ED Sbjct: 284 SFKIIHVGERDDPTTVIEREEWTKTRED 311 >At4g30020.1 68417.m04272 subtilase family protein contains similarity to meiotic serine proteinase TMP GI:6468325 from [Lycopersicon esculentum] Length = 816 Score = 27.1 bits (57), Expect = 9.4 Identities = 14/50 (28%), Positives = 24/50 (48%) Frame = -1 Query: 346 LLRDDCLHETPDVTEALRRLPSHVVDERNFRIVRAIQLSMQKTILPKEEW 197 L+ H +PD E LRR P +R++++ + + Q LP + W Sbjct: 92 LINGFAAHVSPDQAEMLRRAPGVKSVDRDWKVRKLTTHTPQFLGLPTDVW 141 >At2g12900.1 68415.m01408 hypothetical protein similar to transcription factor(bZIP family) VSF-1 GI:3425907 from [Lycopersicon esculentum] Length = 264 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +1 Query: 256 GSFSRQQHGMEVCGVLQLHQEFHASN 333 GS Q+ ME C VLQ +EF SN Sbjct: 217 GSVELQRLKMETCEVLQYRREFDRSN 242 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,681,004 Number of Sequences: 28952 Number of extensions: 225098 Number of successful extensions: 669 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 656 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 669 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1171109464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -