BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0811 (571 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC9E9.04 |||bcap family homolog|Schizosaccharomyces pombe|chr ... 33 0.039 SPBC216.01c ||SPBC713.13c|DNA damage response protein |Schizosac... 25 5.9 SPCC736.02 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||... 25 5.9 SPAC20G4.04c |hus1||checkpoint clamp complex protein Hus1|Schizo... 25 7.8 >SPAC9E9.04 |||bcap family homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 188 Score = 32.7 bits (71), Expect = 0.039 Identities = 28/119 (23%), Positives = 44/119 (36%), Gaps = 3/119 (2%) Frame = +2 Query: 194 MSLQWTIIATFLYTEIAVVLLLTLPIASPSR---WQKFFKSKFLAYISGQASIYFXXXXX 364 M++ + I+ L EI ++L+LP+ R S F + I Sbjct: 1 MTIYYMIVFMLLMVEIVSFVILSLPLPLKVRRAILNAISNSPFAGRVKHVLKITIICILI 60 Query: 365 XXXXXXXDAIREMQKYSNIEPSDHQHLDAEMQGNMRLFRAQRNFYISGFALFLLVVIRR 541 +R ++Y + A F AQRN Y+ G ALFL +V+ R Sbjct: 61 LFADSVRRVVRVTKEYDLAIAAPSTTESARSGYKASQFYAQRNLYLCGSALFLSLVVNR 119 >SPBC216.01c ||SPBC713.13c|DNA damage response protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 836 Score = 25.4 bits (53), Expect = 5.9 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +1 Query: 259 NFADSQSEQMAEVLQ-IEISSLHKRAGIYLFSDSHW 363 N + E +A LQ IE+ S+ +R +Y D +W Sbjct: 22 NEEEELDEAIAAALQKIEVPSIPRRVKVYEMEDENW 57 >SPCC736.02 |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 286 Score = 25.4 bits (53), Expect = 5.9 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -3 Query: 224 TSR*LSIADS*FHYFFNTVISYTMQQTIVE 135 T R +SI D + F T YTM+Q VE Sbjct: 196 TERLISIPDDEVEFCFLTWFEYTMEQNSVE 225 >SPAC20G4.04c |hus1||checkpoint clamp complex protein Hus1|Schizosaccharomyces pombe|chr 1|||Manual Length = 287 Score = 25.0 bits (52), Expect = 7.8 Identities = 16/57 (28%), Positives = 26/57 (45%) Frame = +1 Query: 190 NHESAMDNYRDVSLYRDRSRPPFNFADSQSEQMAEVLQIEISSLHKRAGIYLFSDSH 360 N E D+S + ++R P F + + V ++ISS+ KR I F + H Sbjct: 204 NPELDPSQVEDISRHPSQTRAPEEFVHMRLDSKDLVNMLKISSVAKRV-IACFCEGH 259 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,269,380 Number of Sequences: 5004 Number of extensions: 41831 Number of successful extensions: 105 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 105 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 242064240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -