BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0810 (450 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) 93 1e-19 SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38) 84 6e-17 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 1e-13 SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) 71 3e-13 SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 5e-12 SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) 66 1e-11 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_39934| Best HMM Match : RRM_1 (HMM E-Value=6.5e-24) 53 1e-07 SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0) 49 2e-06 SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) 48 3e-06 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 48 4e-06 SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18) 48 5e-06 SB_37827| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 8e-06 SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013) 46 2e-05 SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) 45 3e-05 SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) 44 4e-05 SB_877| Best HMM Match : RRM_1 (HMM E-Value=1e-15) 44 4e-05 SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-05 SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) 44 6e-05 SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) 44 8e-05 SB_31413| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_28139| Best HMM Match : RRM_1 (HMM E-Value=3.7e-28) 44 8e-05 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 43 1e-04 SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) 43 1e-04 SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) 43 1e-04 SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0) 42 2e-04 SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) 42 3e-04 SB_27480| Best HMM Match : RRM_1 (HMM E-Value=3.7e-18) 42 3e-04 SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) 41 4e-04 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 4e-04 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 40 0.001 SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 38 0.005 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 38 0.005 SB_52510| Best HMM Match : RRM_1 (HMM E-Value=8.1e-21) 37 0.007 SB_46435| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_57661| Best HMM Match : RRM_1 (HMM E-Value=0.017) 36 0.020 SB_18026| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_57434| Best HMM Match : LRR_1 (HMM E-Value=3.9e-13) 34 0.047 SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) 34 0.047 SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28) 34 0.062 SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.062 SB_47831| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.062 SB_56343| Best HMM Match : RRM_1 (HMM E-Value=3.2e-14) 33 0.11 SB_11682| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_47564| Best HMM Match : RRM_1 (HMM E-Value=0.23) 33 0.11 SB_35697| Best HMM Match : RRM_1 (HMM E-Value=1.3e-19) 32 0.19 SB_48994| Best HMM Match : ASC (HMM E-Value=1.3e-11) 31 0.33 SB_11300| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.33 SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35) 31 0.44 SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.44 SB_2941| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.44 SB_41060| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_20581| Best HMM Match : RRM_1 (HMM E-Value=1.7e-07) 31 0.58 SB_11425| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_28070| Best HMM Match : RRM_1 (HMM E-Value=1.3e-07) 31 0.58 SB_19711| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_25551| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.77 SB_24418| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.77 SB_38604| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_28750| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_3920| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_12089| Best HMM Match : RRM_1 (HMM E-Value=7.4e-13) 29 1.3 SB_8368| Best HMM Match : VWA (HMM E-Value=0) 29 1.3 SB_46941| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_13046| Best HMM Match : La (HMM E-Value=5e-23) 29 1.3 SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33) 24 1.7 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_15012| Best HMM Match : zf-CCHC (HMM E-Value=1.1e-05) 29 1.8 SB_51896| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_34062| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_14704| Best HMM Match : Mak16 (HMM E-Value=9.3) 29 1.8 SB_1073| Best HMM Match : Ribosomal_L12 (HMM E-Value=2.2) 29 1.8 SB_39378| Best HMM Match : VWA (HMM E-Value=0) 29 2.3 SB_2375| Best HMM Match : Pentapeptide_2 (HMM E-Value=2.7) 29 2.3 SB_55491| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_50597| Best HMM Match : 7tm_1 (HMM E-Value=2.59941e-42) 28 3.1 SB_44482| Best HMM Match : RRM_1 (HMM E-Value=0.19) 28 3.1 SB_24568| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_18084| Best HMM Match : DUF801 (HMM E-Value=0.37) 28 3.1 SB_42035| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_7529| Best HMM Match : Toxin_29 (HMM E-Value=0.0017) 28 3.1 SB_56987| Best HMM Match : Cornifin (HMM E-Value=1.5) 28 4.1 SB_41149| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_46960| Best HMM Match : Neuromodulin (HMM E-Value=3.6) 28 4.1 SB_23339| Best HMM Match : I-set (HMM E-Value=1.3e-07) 28 4.1 SB_20267| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_20263| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_1065| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_38223| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_56231| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_43316| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_39141| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_20262| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_19847| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_15580| Best HMM Match : Pentapeptide (HMM E-Value=0.2) 27 5.4 SB_37378| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_23644| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_14896| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_4594| Best HMM Match : K_tetra (HMM E-Value=5.6e-24) 27 7.2 SB_4001| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0056) 27 7.2 SB_54036| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_28695| Best HMM Match : Ras (HMM E-Value=0) 27 7.2 SB_23204| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_23116| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_58045| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 27 9.5 SB_53221| Best HMM Match : zf-CCHC (HMM E-Value=0.061) 27 9.5 SB_23047| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_22347| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_21913| Best HMM Match : C2 (HMM E-Value=0.31) 27 9.5 SB_13452| Best HMM Match : Mak16 (HMM E-Value=2.6) 27 9.5 SB_3425| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_44810| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_35887| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_23753| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_21644| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_20991| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 SB_11641| Best HMM Match : 7tm_1 (HMM E-Value=2.1e-33) 27 9.5 SB_3318| Best HMM Match : Xan_ur_permease (HMM E-Value=7.20267e-43) 27 9.5 >SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) Length = 328 Score = 93.1 bits (221), Expect = 1e-19 Identities = 51/118 (43%), Positives = 65/118 (55%) Frame = +3 Query: 96 GDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRG 275 G S D N DD KLFVGGLS+ETT + L+++F YGE+ +++K D TGR RG Sbjct: 12 GTSLDSNKTRMTKDDDIGKLFVGGLSYETTKESLKEYFSKYGELVGVDIKMDALTGRPRG 71 Query: 276 FAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFF 449 FAF+ FK D + I K R KIFVGGL E SD++IR +F Sbjct: 72 FAFVQFKHQSEADAIDPKPAAPIG------KPPHLRVKKIFVGGLKPETSDEKIREYF 123 Score = 68.9 bits (161), Expect = 2e-12 Identities = 30/77 (38%), Positives = 51/77 (66%), Gaps = 1/77 (1%) Frame = +3 Query: 147 RKLFVGGLSWETTDKELRDHFG-AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 323 +K+FVGGL ET+D+++R++FG AY ++ I T+ ++ R RGF F+ F + +++DK+ Sbjct: 103 KKIFVGGLKPETSDEKIREYFGKAYAPVKEIEYITEHSSNRRRGFCFVSFDSEDTVDKIC 162 Query: 324 AAGEHTINNKKVDPKKA 374 H I KV+ K+A Sbjct: 163 ETQFHNIEGNKVEVKRA 179 >SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38) Length = 496 Score = 83.8 bits (198), Expect = 6e-17 Identities = 39/113 (34%), Positives = 76/113 (67%), Gaps = 12/113 (10%) Frame = +3 Query: 147 RKLFVGGLSWETTDKELRDHFGAYGEI-ESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 323 RK+F+GGL+W TT++ L+D+F +G I + + +K D GRSRGF F+ +++ +S+++V+ Sbjct: 50 RKIFIGGLNWNTTEEGLKDYFSQWGTIVDCVIMKRD---GRSRGFGFVTYESSDSVNEVL 106 Query: 324 AAGEHTINNKKVDPKK-----------AKARHGKIFVGGLSSEISDDEIRNFF 449 +H +++++++PK+ A ++ KIFVGGL+S +++I+ +F Sbjct: 107 KKKDHVLDDREIEPKRSVPRDESGAPEAMSKTRKIFVGGLASTTVEEDIKEYF 159 Score = 58.0 bits (134), Expect = 3e-09 Identities = 31/84 (36%), Positives = 51/84 (60%), Gaps = 7/84 (8%) Frame = +3 Query: 147 RKLFVGGLSWETTDKELRDHFGAY------GEIESINVKTD-PNTGRSRGFAFIVFKAPE 305 RK+FVGGL+ T +++++++F + GE+ +++K D N R RGFAF+ F E Sbjct: 139 RKIFVGGLASTTVEEDIKEYFNSLCRKNGMGEVIDVDLKRDRDNPKRIRGFAFVTFDNDE 198 Query: 306 SIDKVMAAGEHTINNKKVDPKKAK 377 ++KV A H I K+ + KKA+ Sbjct: 199 IVEKVCAMKYHEIRMKQCEVKKAE 222 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 72.9 bits (171), Expect = 1e-13 Identities = 48/124 (38%), Positives = 69/124 (55%), Gaps = 15/124 (12%) Frame = +3 Query: 114 NSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 293 N E D KLFVGGL+ ETT++ LR++F AYGE+ + V D T +SRGF ++ F Sbjct: 3 NRQENTNNDPRAKLFVGGLNRETTNETLREYFEAYGELTDVVVICDSATKKSRGFGYVTF 62 Query: 294 ---KAPESI--DKVMAAGEHTINNKKVDPKKAKARHG----------KIFVGGLSSEISD 428 K ++ DKV G H I+ K+V+ K+A R KIFVGGL + + Sbjct: 63 ADYKVTRNVLKDKV-ENGAHRIDGKEVEVKRAIPRDDNSATSHEKTKKIFVGGLPEDATK 121 Query: 429 DEIR 440 ++I+ Sbjct: 122 EDIQ 125 Score = 41.5 bits (93), Expect = 3e-04 Identities = 35/129 (27%), Positives = 61/129 (47%), Gaps = 14/129 (10%) Frame = +3 Query: 39 FAQDITTDNQLNGNAENGGG--DSQDHNSAEAPGRDDD--------RKLFVGGLSWETTD 188 FA T N L ENG D ++ A RDD+ +K+FVGGL + T Sbjct: 62 FADYKVTRNVLKDKVENGAHRIDGKEVEVKRAIPRDDNSATSHEKTKKIFVGGLPEDATK 121 Query: 189 KELRDHFGAYGE--IESINV--KTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKK 356 +++++ + E ++ +++ K + T + RGFAF+ + D++ + + K Sbjct: 122 EDIQEAIESLLEEKVDKVDLIMKKEDET-KHRGFAFVELNNEDQADELCCVKKIHVKGKM 180 Query: 357 VDPKKAKAR 383 V+ KKA R Sbjct: 181 VEAKKATPR 189 Score = 26.6 bits (56), Expect = 9.5 Identities = 9/20 (45%), Positives = 16/20 (80%) Frame = +3 Query: 390 KIFVGGLSSEISDDEIRNFF 449 K+FVGGL+ E +++ +R +F Sbjct: 15 KLFVGGLNRETTNETLREYF 34 >SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) Length = 842 Score = 71.3 bits (167), Expect = 3e-13 Identities = 34/85 (40%), Positives = 54/85 (63%) Frame = +3 Query: 195 LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 374 LR HF +GE++ V DP T RSRGF F+ FK P+++D V+ +G +++D KK Sbjct: 124 LRQHFEKFGELKECVVMRDPVTKRSRGFGFLTFKDPKAVDVVLNSGA-----QELDGKKM 178 Query: 375 KARHGKIFVGGLSSEISDDEIRNFF 449 KIF+GGLS+ S+++++ +F Sbjct: 179 VTTTKKIFIGGLSTNTSEEDMKKYF 203 Score = 32.3 bits (70), Expect = 0.19 Identities = 9/27 (33%), Positives = 22/27 (81%) Frame = +3 Query: 147 RKLFVGGLSWETTDKELRDHFGAYGEI 227 +K+F+GGLS T++++++ +F +G++ Sbjct: 183 KKIFIGGLSTNTSEEDMKKYFSQFGKV 209 >SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 67.3 bits (157), Expect = 5e-12 Identities = 37/104 (35%), Positives = 56/104 (53%), Gaps = 5/104 (4%) Frame = +3 Query: 153 LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 332 L V GL + TT+ E++++F +GEI+ VK DPNT RSRGF F+ FK E V++ Sbjct: 117 LIVLGLPYATTESEMKEYFTRFGEIDFCEVKLDPNTRRSRGFGFVRFKKDEDAKNVLST- 175 Query: 333 EHTINNKKVD-----PKKAKARHGKIFVGGLSSEISDDEIRNFF 449 H I + + PK+ K+FVG L ++ + +F Sbjct: 176 SHRIQGRLCEVRLPRPKEELNVPKKLFVGRLPESTTEKTLMEYF 219 Score = 33.9 bits (74), Expect = 0.062 Identities = 17/44 (38%), Positives = 25/44 (56%) Frame = +3 Query: 147 RKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGF 278 +KLFVG L TT+K L ++F +GE+ + + P R GF Sbjct: 199 KKLFVGRLPESTTEKTLMEYFAQFGEVTDVYI---PKPFRHFGF 239 >SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 420 Score = 66.1 bits (154), Expect = 1e-11 Identities = 36/103 (34%), Positives = 58/103 (56%) Frame = +3 Query: 141 DDRKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 320 + R +FVGGL+ T ++ L+D+F +GE+ES+ + G SR + F++FK + K Sbjct: 78 NSRSVFVGGLASGTDEEGLKDYFEQFGEVESVRIMR-TFLGYSRNYGFVLFK-DDGPSKE 135 Query: 321 MAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFF 449 + H IN K VD K++ I+VGGL S ++ +R F Sbjct: 136 VLKKSHVINGKTVDVGKSR-NFRVIYVGGLPSHFTEQTVREHF 177 Score = 52.0 bits (119), Expect = 2e-07 Identities = 21/72 (29%), Positives = 42/72 (58%) Frame = +3 Query: 144 DRKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 323 +R LFV LS +T + ++ +F YG++ +++ TD TG+S+G + + P +++K++ Sbjct: 318 ERTLFVDNLSEDTKELDVLRYFRPYGQVAKVHILTDRETGKSKGCGVVKLRHPGTVNKIL 377 Query: 324 AAGEHTINNKKV 359 H I +V Sbjct: 378 EEPVHVIGKSQV 389 Score = 41.9 bits (94), Expect = 2e-04 Identities = 31/107 (28%), Positives = 53/107 (49%), Gaps = 6/107 (5%) Frame = +3 Query: 147 RKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 326 +KL V L ++TT ELR++F GE+ I++ N+ + A + F+ + I KV+ Sbjct: 236 KKLMVQDLDFDTTVDELREYFEKCGELTGIDLLI--NSEKRTCAAIVFFRNLKDIKKVVE 293 Query: 327 AGEHTINNKKV------DPKKAKARHGKIFVGGLSSEISDDEIRNFF 449 HTI KV + +K R +FV LS + + ++ +F Sbjct: 294 E-NHTIKGLKVRTVQLPNEEKQGVRERTLFVDNLSEDTKELDVLRYF 339 Score = 35.5 bits (78), Expect = 0.020 Identities = 23/101 (22%), Positives = 44/101 (43%) Frame = +3 Query: 147 RKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 326 R ++VGGL T++ +R+HF +G IE++ + + G G + E + + Sbjct: 157 RVIYVGGLPSHFTEQTVREHFKKFGVIEAVKFIENTSVGAKTGXXXXE-EDQEILGCPVT 215 Query: 327 AGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFF 449 + D + K+ V L + + DE+R +F Sbjct: 216 VRARSGKESNEDLMAKVIQSKKLMVQDLDFDTTVDELREYF 256 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = +3 Query: 345 NNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFF 449 N+ PK + +FVGGL+S ++ ++++F Sbjct: 66 NSTLPSPKDIEKNSRSVFVGGLASGTDEEGLKDYF 100 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 59.7 bits (138), Expect = 1e-09 Identities = 40/120 (33%), Positives = 70/120 (58%), Gaps = 19/120 (15%) Frame = +3 Query: 138 DDDR--KLFVGGLSWETTDKELRDHF-----GAYGEIESINVKTDPNTGRSRGFAFIVF- 293 DD + KLFVGGL+ +TT++ +R +F G+ ++ S+++ P G+SR F F+ F Sbjct: 3 DDSKLMKLFVGGLNEDTTEETVRAYFKSFCEGSEADVSSVSLAKTPE-GKSRKFCFVEFS 61 Query: 294 KAPESIDKVMAAGE-HTINNKKVDPKKAKARHG----------KIFVGGLSSEISDDEIR 440 + ID ++ E H+I+NK+V+ K+A R K+F+GGL E S+++++ Sbjct: 62 NGSDIIDNIVFNFESHSIDNKQVEVKRAMPRDDPNELAHVRTKKLFIGGLKDEHSEEDVK 121 Score = 40.3 bits (90), Expect = 7e-04 Identities = 20/78 (25%), Positives = 38/78 (48%), Gaps = 2/78 (2%) Frame = +3 Query: 147 RKLFVGGLSWETTDKELRDHFGAYGEIESINVKT--DPNTGRSRGFAFIVFKAPESIDKV 320 +KLF+GGL E ++++++ + +K D T + +G+ F+ F +DK+ Sbjct: 104 KKLFIGGLKDEHSEEDVKTALAPLSPFAPLEIKMVRDRETNKFKGYCFVNFPNEHIVDKL 163 Query: 321 MAAGEHTINNKKVDPKKA 374 + K V+ KKA Sbjct: 164 YLVRHIQVKGKDVEMKKA 181 >SB_39934| Best HMM Match : RRM_1 (HMM E-Value=6.5e-24) Length = 343 Score = 53.2 bits (122), Expect = 1e-07 Identities = 29/103 (28%), Positives = 57/103 (55%), Gaps = 2/103 (1%) Frame = +3 Query: 147 RKLFVGGLSWETTDKELRDHFGAYGE-IESIN-VKTDPNTGRSRGFAFIVFKAPESIDKV 320 R +FVG L T + + ++F GE +E + ++T +G+S+GFAF+ + E+++ V Sbjct: 42 RTIFVGSLHPSTVESTIFEYFSTLGEQVEHVKCIRT--LSGKSKGFAFVRLRKKEAVESV 99 Query: 321 MAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFF 449 + +H I+N V +K + + K+ + + S I + +I F Sbjct: 100 LGRDDHVIDNSDVSMEK-QDTYRKVILKNIPSSIGESQILEHF 141 Score = 34.3 bits (75), Expect = 0.047 Identities = 21/114 (18%), Positives = 51/114 (44%), Gaps = 2/114 (1%) Frame = +3 Query: 108 DHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI 287 D++ +D RK+ + + + ++ +HF + GEI S+ + + T +G + Sbjct: 108 DNSDVSMEKQDTYRKVILKNIPSSIGESQILEHFSSSGEIASVYIPENLKTKERKGHCIV 167 Query: 288 VFKAPESIDKVMAAGEHTINNKKV--DPKKAKARHGKIFVGGLSSEISDDEIRN 443 F + +V+ +H I+ + + + K+ + L ++ D+I+N Sbjct: 168 TFASVTEAFEVVKKRKHHIHGYDIITEYYMNLKQPKKLCLKNLPYNVTVDQIKN 221 >SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 49.6 bits (113), Expect = 1e-06 Identities = 29/133 (21%), Positives = 62/133 (46%), Gaps = 6/133 (4%) Frame = +3 Query: 69 LNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAYGEIESINVKT 248 ++ N++ D +H E D+ L + + + ++++ FG G + S + Sbjct: 1 MDDNSKAMAEDINNHEPMENGTSDERTNLIINYVPPSMSQEDIKKIFGTVGNVTSCKLIR 60 Query: 249 DPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNK--KVD---PKKAKARHGKIFVGGL 410 D TG+S G+AF+ + P+ +K V + NK KV P + ++ +++ GL Sbjct: 61 DRATGQSLGYAFVNYDNPDDANKAVREMNGARLQNKTLKVSFARPSSTEIKNANLYISGL 120 Query: 411 SSEISDDEIRNFF 449 ++ ++E+ F Sbjct: 121 PKDMKEEEVEALF 133 Score = 27.1 bits (57), Expect = 7.2 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = +3 Query: 153 LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTG 263 +FV GL E T L F YG I +I +K D G Sbjct: 274 IFVYGLPQEATPLFLYKLFSPYGAITNIELKLDKGYG 310 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 49.2 bits (112), Expect = 2e-06 Identities = 20/62 (32%), Positives = 39/62 (62%) Frame = +3 Query: 126 APGRDDDRKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 305 A G + RKL++G L++ + + E+ F +G +E +++ D +GRSRGF F++ ++ + Sbjct: 2 ADGENRGRKLYIGNLNFNSDEGEIEQAFEEFG-VEKVDILRDKESGRSRGFGFVLLQSAD 60 Query: 306 SI 311 I Sbjct: 61 QI 62 >SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 1026 Score = 48.8 bits (111), Expect = 2e-06 Identities = 25/104 (24%), Positives = 55/104 (52%), Gaps = 2/104 (1%) Frame = +3 Query: 24 ANNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRD--DDRKLFVGGLSWETTDKEL 197 +++D + ++ D+ N ++ D++S + D + +F+ LS+++T K + Sbjct: 373 SDDDEDVKHMSKDDNNNEKSDEDDASEDDNHSQRSKPSDVKEGLTVFIRNLSFDSTQKNI 432 Query: 198 RDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 329 + F +G+I V D T S+G AF+ +++ ES+ + +AA Sbjct: 433 TNLFKQFGDIAYCKVVVDHLTQHSKGSAFVKYRSAESVTQCLAA 476 Score = 27.5 bits (58), Expect = 5.4 Identities = 23/93 (24%), Positives = 40/93 (43%) Frame = +3 Query: 102 SQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFA 281 S+ + +AP D R + + GL T+K++ GE+E P G A Sbjct: 145 SKSKSLRKAPQTDAGRTVILSGLPASITEKQIYKRCRKLGEVEK---TIFPVAGHDSPTA 201 Query: 282 FIVFKAPESIDKVMAAGEHTINNKKVDPKKAKA 380 ++FK+ + + +A +N K + K KA Sbjct: 202 SLLFKSYKDARQAVA----KLNGKTLKGVKVKA 230 >SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) Length = 407 Score = 48.4 bits (110), Expect = 3e-06 Identities = 21/98 (21%), Positives = 48/98 (48%) Frame = +3 Query: 138 DDDRKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDK 317 D R +F+G L ++ ++ LR+ F G +ES+ + D TG +GF +++F++ +++ Sbjct: 53 DHQRSVFIGNLPFDIEEEPLRELFTTCGNVESVRLIRDRKTGIGKGFGYVLFESKDAVVF 112 Query: 318 VMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDD 431 + +K+ +K + F+ + D+ Sbjct: 113 ALKMNNAEFKGRKIRVFPSKDKPQTEFISHIQVRFRDN 150 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 48.0 bits (109), Expect = 4e-06 Identities = 29/80 (36%), Positives = 43/80 (53%), Gaps = 3/80 (3%) Frame = +3 Query: 117 SAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAYGEI-ESINVKTDPNTGRSRGFAFIVF 293 SA D LF+G L E +K L D F A+G I ++ + D +TG S+GFAFI F Sbjct: 90 SAHNKNLDVGANLFIGNLDTEVDEKLLYDTFSAFGVILQTPKIMRDSDTGNSKGFAFINF 149 Query: 294 KAPESIDKVMAA--GEHTIN 347 + ++ D + A G++ N Sbjct: 150 ASFDASDAAIEAMNGQYLCN 169 >SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18) Length = 268 Score = 47.6 bits (108), Expect = 5e-06 Identities = 23/60 (38%), Positives = 37/60 (61%) Frame = +3 Query: 135 RDDDRKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID 314 +D +++FV G + ETT+ ELR F YG ++ + D + G S+G+AFI F++ E D Sbjct: 4 QDISKRIFVKGFNRETTESELRAFFEEYGVVKESKIVRDKH-GVSKGYAFITFESQEVAD 62 >SB_37827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 628 Score = 46.8 bits (106), Expect = 8e-06 Identities = 26/86 (30%), Positives = 45/86 (52%) Frame = +3 Query: 54 TTDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAYGEIES 233 T DN+ +G+ ++ D D + + DDD GG + ++ +H A G +E+ Sbjct: 428 TGDNR-DGDDDDDDDDDDDDDDDDDDDDDDDDDDDGGGDDDDDYERGAINHSNA-GPLEN 485 Query: 234 INVKTDPNTGRSRGFAFIVFKAPESI 311 + + TD NTG+ R F F+ F +P S+ Sbjct: 486 VRIPTDKNTGQQRSFGFVEFSSPVSV 511 >SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013) Length = 665 Score = 45.6 bits (103), Expect = 2e-05 Identities = 21/45 (46%), Positives = 27/45 (60%) Frame = +3 Query: 249 DPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 383 D T R RGF F+ F++ S DK H INNKKV+ KKA+ + Sbjct: 5 DKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPK 49 >SB_29861| Best HMM Match : RRM_1 (HMM E-Value=1.10002e-42) Length = 1531 Score = 44.8 bits (101), Expect = 3e-05 Identities = 32/123 (26%), Positives = 58/123 (47%), Gaps = 3/123 (2%) Frame = +3 Query: 90 GGGDSQDHNSAEA-PGRDDDRKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGR 266 GGG +++ E PG R LFVG + TT +L++ F YGE+ +++K P Sbjct: 231 GGGSISNYSEDEFDPGCT--RTLFVGNIEKTTTYGDLKEAFERYGEVIDVDIKKQPG--- 285 Query: 267 SRGFAFIVF-KAPESIDKVMAAGEHTINNKKVDPKKAKARH-GKIFVGGLSSEISDDEIR 440 + +AF+ F + +I + +V K I+VGG+++ +S+ ++ Sbjct: 286 NNPYAFVQFAELSSAIQARRKMDREYVGRNRVKVGFGKVNPINTIWVGGVTNSLSEQQVE 345 Query: 441 NFF 449 F Sbjct: 346 RHF 348 Score = 30.3 bits (65), Expect = 0.77 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +3 Query: 141 DDRKLFVGGLSWETTDKELRDHFGAYGEIESINV--KTDPNTGRSRGFAFI 287 + R L+VG L ++++ HF YG +ES+ + K GR+ F+ Sbjct: 4 ETRHLWVGNLPENIREEDIVKHFTRYGRVESVKILPKRSAEGGRASFVDFV 54 Score = 27.9 bits (59), Expect = 4.1 Identities = 9/35 (25%), Positives = 21/35 (60%) Frame = +3 Query: 153 LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPN 257 ++VGG++ +++++ HFG YG + + + N Sbjct: 330 IWVGGVTNSLSEQQVERHFGRYGRVTKVVINRVTN 364 >SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) Length = 291 Score = 44.4 bits (100), Expect = 4e-05 Identities = 20/55 (36%), Positives = 31/55 (56%) Frame = +3 Query: 150 KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID 314 KLFVGG+ +E+ D LR F +GEI V D T +S+G+ F+ ++ + Sbjct: 11 KLFVGGIPYESGDDALRKFFAQFGEIREAVVIKDRVTKKSKGYGFVTMATSDAAE 65 Score = 28.7 bits (61), Expect = 2.3 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 390 KIFVGGLSSEISDDEIRNFF 449 K+FVGG+ E DD +R FF Sbjct: 11 KLFVGGIPYESGDDALRKFF 30 >SB_877| Best HMM Match : RRM_1 (HMM E-Value=1e-15) Length = 145 Score = 44.4 bits (100), Expect = 4e-05 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 2/78 (2%) Frame = +3 Query: 141 DDRKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 320 D R +++ + L FG YG IE +++ TG+S+GF ++ ++ ES + Sbjct: 61 DQRTIYIRDFRPDIRKSSLESVFGPYGAIEDLSI-IRTQTGKSKGFGYVTYENAESAQRA 119 Query: 321 MAAGEHTINNKKV--DPK 368 + AG H I+ K V +PK Sbjct: 120 L-AGTHIIDGKWVIAEPK 136 >SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 44.0 bits (99), Expect = 6e-05 Identities = 23/65 (35%), Positives = 33/65 (50%) Frame = +3 Query: 129 PGRDDDRKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 308 P D L V L++ TT ++L+ F YG++ I + D NT SRGFAF+ F Sbjct: 10 PEIDGMTSLKVDNLTYRTTVEDLKQVFKKYGDLGDIYIPRDRNTHESRGFAFVRFYEKRD 69 Query: 309 IDKVM 323 + M Sbjct: 70 AEDAM 74 >SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 718 Score = 44.0 bits (99), Expect = 6e-05 Identities = 21/57 (36%), Positives = 30/57 (52%) Frame = +3 Query: 153 LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 323 L++ L D+ LR+ F YG I S V D + G S+GF F+ F +PE K + Sbjct: 214 LYIKNLDDPIDDERLREEFSPYGTISSAKVMKD-DKGNSKGFGFVCFSSPEEATKAV 269 Score = 41.9 bits (94), Expect = 2e-04 Identities = 21/80 (26%), Positives = 44/80 (55%) Frame = +3 Query: 153 LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 332 ++V + D+++++ G+I S+ V TDP G+S+GF F+ F+ PE ++ + Sbjct: 111 VYVKNFGDDMDDEQMKEICAEAGKIVSLKVMTDPE-GKSKGFGFVSFETPEEAEEAV--- 166 Query: 333 EHTINNKKVDPKKAKARHGK 392 + +N K++ ++ A K Sbjct: 167 -NVLNGKEIGGRRLWAGRAK 185 Score = 39.9 bits (89), Expect = 0.001 Identities = 23/72 (31%), Positives = 39/72 (54%), Gaps = 3/72 (4%) Frame = +3 Query: 153 LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP---ESIDKVM 323 L+VG L+ + T+ L + F G + SI V D T RS G+A++ F+ P +++ + Sbjct: 15 LYVGDLAPDVTEAMLYEKFSTAGSVLSIRVCRDLVTRRSLGYAYVNFQQPGHDAALEAIA 74 Query: 324 AAGEHTINNKKV 359 +N+KKV Sbjct: 75 RVDGMLLNDKKV 86 >SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) Length = 1313 Score = 43.6 bits (98), Expect = 8e-05 Identities = 17/58 (29%), Positives = 33/58 (56%) Frame = +3 Query: 150 KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 323 KL+V L+ +++ F YG ++++++ TD SRGFA++ + PE +K + Sbjct: 1158 KLYVAHLTRNVNKDHVQEIFSVYGRVKTVDLPTDRTNNLSRGFAYVEYVDPEECEKAL 1215 >SB_31413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 381 Score = 43.6 bits (98), Expect = 8e-05 Identities = 29/101 (28%), Positives = 51/101 (50%), Gaps = 5/101 (4%) Frame = +3 Query: 150 KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 329 ++F+G + + + EL GEI ++ DP TG ++GFAF F S + + Sbjct: 154 EVFIGKIPRDCLEDELIPLLEKCGEIREFRLQMDPATGLNKGFAFCTFTEQTSAYQAIT- 212 Query: 330 GEHTINNKKVDPKK----AKAR-HGKIFVGGLSSEISDDEI 437 T+N+K + P + K+R + ++FV G+ S +EI Sbjct: 213 ---TLNDKDIRPGRRLAICKSRSNSRLFVKGIPKRKSKEEI 250 >SB_28139| Best HMM Match : RRM_1 (HMM E-Value=3.7e-28) Length = 419 Score = 43.6 bits (98), Expect = 8e-05 Identities = 33/142 (23%), Positives = 57/142 (40%), Gaps = 3/142 (2%) Frame = +3 Query: 33 DNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFG 212 D A +T+ ++ D D + L++ GL TTD +L Sbjct: 62 DKKAYSVTSSQSPGLSSGRSSSDRMDSLPDTGEEKLSKTNLYIRGLKANTTDDDLVRLCH 121 Query: 213 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH-- 386 YG I S D +T +G+ F+ F++P S K +AA + NK + + AK + Sbjct: 122 KYGTIISTKAILDKDTNLCKGYGFVDFESPISAQKAVAA----LVNKGIQAQMAKQQEQD 177 Query: 387 -GKIFVGGLSSEISDDEIRNFF 449 +++ L + + N F Sbjct: 178 PTNLYIQNLPQNCDEAMLENMF 199 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 43.6 bits (98), Expect = 8e-05 Identities = 24/95 (25%), Positives = 50/95 (52%), Gaps = 3/95 (3%) Frame = +3 Query: 141 DDRKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 320 ++ K ++G L ++ + +L+D F Y ++ + V +D T R RGFAF+ F + ++++ Sbjct: 228 EECKCYIGNLDFKVNEADLQDRFSRY-DVVDVQVISDRETQRPRGFAFVTFGSKKNMEDA 286 Query: 321 ---MAAGEHTINNKKVDPKKAKARHGKIFVGGLSS 416 + E + KV+ +++ + G GG S Sbjct: 287 INELDGQEFDGRSMKVNQARSREQRGGGRGGGYRS 321 Score = 35.1 bits (77), Expect = 0.027 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +3 Query: 231 SINVKTDPNTGRSRGFAFIVFKAPESIDKVM 323 S+ V TD TGR RGF F+ F + + +DK + Sbjct: 37 SVKVITDRETGRPRGFGFVTFGSEDEMDKAI 67 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 43.2 bits (97), Expect = 1e-04 Identities = 18/61 (29%), Positives = 35/61 (57%) Frame = +3 Query: 141 DDRKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 320 ++ + ++G LS+ ++ L + F ++ + V TD TGR RGF F+ F + E ++K Sbjct: 3 EEYRCYIGNLSYSVDEQALEEKFHGC-DVVDVKVITDRETGRPRGFGFVTFGSKEEMEKA 61 Query: 321 M 323 + Sbjct: 62 I 62 >SB_45423| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 514 Score = 43.2 bits (97), Expect = 1e-04 Identities = 17/58 (29%), Positives = 34/58 (58%) Frame = +3 Query: 150 KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 323 +L+VG L + T+ ++ F +G ++S+ + D T RS+G+ F+ F+ E+ + M Sbjct: 243 RLYVGSLHFNITEAMVKAVFEPFGTVDSVQLIYDSETNRSKGYGFVQFREAEAAKRAM 300 >SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 43.2 bits (97), Expect = 1e-04 Identities = 20/59 (33%), Positives = 32/59 (54%) Frame = +3 Query: 153 LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 329 ++VG L + T+ +L F YG++ + + D T SRG AFI+F +S +AA Sbjct: 12 VYVGNLPYSLTNSDLHKVFERYGKVVKVTILRDKETRESRGVAFILFIDRQSAQNAVAA 70 >SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 593 Score = 42.7 bits (96), Expect = 1e-04 Identities = 16/53 (30%), Positives = 33/53 (62%) Frame = +3 Query: 150 KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 308 +++VG +++E ++ +R F +G I I++ DP + +GFAF+ + PE+ Sbjct: 103 RVYVGSINFELREEHIRTAFHPFGPINKIDLSWDPLNMKHKGFAFVEYDLPEA 155 Score = 35.5 bits (78), Expect = 0.020 Identities = 11/60 (18%), Positives = 36/60 (60%) Frame = +3 Query: 150 KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 329 ++++ + + + +++ F A+G++ ++ +P TG+ +G+ FI ++ +S + +A+ Sbjct: 200 RIYIASVHPDLLEDDIKSVFEAFGKVVHCSLSKEPMTGKHKGYGFIEYENQQSANDAIAS 259 >SB_18756| Best HMM Match : Sterol_desat (HMM E-Value=0) Length = 672 Score = 41.9 bits (94), Expect = 2e-04 Identities = 19/61 (31%), Positives = 29/61 (47%) Frame = +3 Query: 141 DDRKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 320 +D ++F G L E TD+ L F Y + D + +S+G+ F+ FK P K Sbjct: 215 NDFRIFCGDLGSEVTDESLTRAFAKYTSFLKAKIVRDKKSNKSKGYGFVSFKDPNDFIKA 274 Query: 321 M 323 M Sbjct: 275 M 275 >SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) Length = 298 Score = 41.5 bits (93), Expect = 3e-04 Identities = 19/53 (35%), Positives = 29/53 (54%) Frame = +3 Query: 147 RKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPE 305 R +VGGL+ E +K L F +G+I + + D T + RGF F+ F+ E Sbjct: 5 RVAYVGGLAEEVDEKVLHAAFIPFGDITDVQIPMDYTTSKHRGFGFVEFEFAE 57 >SB_27480| Best HMM Match : RRM_1 (HMM E-Value=3.7e-18) Length = 209 Score = 41.5 bits (93), Expect = 3e-04 Identities = 28/82 (34%), Positives = 39/82 (47%), Gaps = 3/82 (3%) Frame = +3 Query: 81 AENGGGDSQDHNSAEAPGRD---DDRKLFVGGLSWETTDKELRDHFGAYGEIESINVKTD 251 A + G +D + P D D LFV L+ TTD++L F +G I S V D Sbjct: 95 ARSPNGLIRDDRIGDIPDADIKPPDNVLFVCKLNPVTTDEDLEIIFSRFGTILSCEVIRD 154 Query: 252 PNTGRSRGFAFIVFKAPESIDK 317 TG S +AFI F+ E ++ Sbjct: 155 QKTGESLQYAFIEFEKDEDCER 176 >SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1291 Score = 41.5 bits (93), Expect = 3e-04 Identities = 16/49 (32%), Positives = 30/49 (61%) Frame = +3 Query: 138 DDDRKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAF 284 D K+F+GGL + ++++ ++GE+ + N+ D TG S+G+AF Sbjct: 670 DSPHKIFIGGLPNYLNEDQVKELLSSFGELRAFNLVKDSATGLSKGYAF 718 >SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 41.5 bits (93), Expect = 3e-04 Identities = 22/81 (27%), Positives = 41/81 (50%), Gaps = 21/81 (25%) Frame = +3 Query: 270 RGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA---------------------KARH 386 +GF F+ F+ P +I+ V+A H ++ K +DPK A A Sbjct: 142 KGFGFVTFRDPATIESVLAKKPHILDGKTIDPKPAVPRGPGQQAQTGAVMGGPQRGSAND 201 Query: 387 GKIFVGGLSSEISDDEIRNFF 449 GK+F+GGL+ ++++++ +F Sbjct: 202 GKVFIGGLAFGTTEEDLKEYF 222 Score = 39.9 bits (89), Expect = 0.001 Identities = 14/33 (42%), Positives = 26/33 (78%) Frame = +3 Query: 132 GRDDDRKLFVGGLSWETTDKELRDHFGAYGEIE 230 G +D K+F+GGL++ TT+++L+++F YG +E Sbjct: 197 GSANDGKVFIGGLAFGTTEEDLKEYFSTYGMVE 229 >SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) Length = 392 Score = 41.1 bits (92), Expect = 4e-04 Identities = 16/54 (29%), Positives = 32/54 (59%) Frame = +3 Query: 147 RKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 308 R +FVG + +E ++++L++ F G + S + D TG+ +G+ F +K E+ Sbjct: 25 RSVFVGNIPYEASEEQLKEIFSEVGPVISFRLVFDRETGKPKGYGFCEYKDQET 78 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 41.1 bits (92), Expect = 4e-04 Identities = 25/80 (31%), Positives = 43/80 (53%) Frame = +3 Query: 153 LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 332 L+VGGL + T+++LRDHF +GE+ SI++ N AF+ F + + + AA Sbjct: 306 LYVGGLEGKVTEQDLRDHFYQFGELRSISMVPRQNC------AFVCFTSRAAAE---AAA 356 Query: 333 EHTINNKKVDPKKAKARHGK 392 + + N + ++ K GK Sbjct: 357 DRSFNKLILKGRRLKIMWGK 376 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 39.9 bits (89), Expect = 0.001 Identities = 27/87 (31%), Positives = 40/87 (45%), Gaps = 3/87 (3%) Frame = +3 Query: 75 GNAENGGGDSQDHNSAEAPGRDDD---RKLFVGGLSWETTDKELRDHFGAYGEIESINVK 245 GN GGG + + GRD + L V LS++TT L A+ + V Sbjct: 262 GNTPRGGGRGRGGRGGFSGGRDQNPPNSSLIVRNLSYDTTTDSLG---AAFEGCSNAKVI 318 Query: 246 TDPNTGRSRGFAFIVFKAPESIDKVMA 326 D +G SRGF F+ + E+ KV++ Sbjct: 319 FDRESGESRGFGFVDYDDVETAKKVLS 345 Score = 35.1 bits (77), Expect = 0.027 Identities = 23/85 (27%), Positives = 41/85 (48%), Gaps = 2/85 (2%) Frame = +3 Query: 141 DDRKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKV 320 ++ +F+G LS++ ++ L F G + V T GRSRGF + F + E +K Sbjct: 178 EEMSVFLGNLSFDADEETLAAFFEEKGLSATCRVIT--QEGRSRGFGYADFTSKEDYNKA 235 Query: 321 MAA-GEHTINNK-KVDPKKAKARHG 389 + GE + +++P +K G Sbjct: 236 LELNGEDCCGREIRINPANSKPSRG 260 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 39.5 bits (88), Expect = 0.001 Identities = 24/90 (26%), Positives = 44/90 (48%), Gaps = 1/90 (1%) Frame = +3 Query: 141 DDRKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAP-ESIDK 317 +D +++VG L + +K+L D F YG I +++K G FAF+ F+ P ++ D Sbjct: 259 NDCRVYVGNLPQDVREKDLHDIFYKYGHIADVDLKN--RRGAGPPFAFVEFEDPRDAEDA 316 Query: 318 VMAAGEHTINNKKVDPKKAKARHGKIFVGG 407 V H + ++ + + G+ GG Sbjct: 317 VKGRDGHEFDGYRIRVEFPRGGSGRGGGGG 346 Score = 27.1 bits (57), Expect = 7.2 Identities = 16/59 (27%), Positives = 25/59 (42%) Frame = +3 Query: 75 GNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAYGEIESINVKTD 251 G GGG P R D ++ V GL + ++L+DH G++ +V D Sbjct: 356 GGGGRGGGGGFSSRGRGPPPRRSDFRVQVSGLPPTGSWQDLKDHMREAGDVLFTDVFKD 414 >SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 721 Score = 39.1 bits (87), Expect = 0.002 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 3/73 (4%) Frame = +3 Query: 153 LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFI---VFKAPESIDKVM 323 LFV + E + ++ + F YGEI++++V D TG +G+A + FK +S + + Sbjct: 295 LFVTNIHEEAQEDDIHELFSDYGEIKNLHVNLDRRTGFIKGYALVEYETFKEAQSALEAL 354 Query: 324 AAGEHTINNKKVD 362 E N VD Sbjct: 355 NGAEMLGQNISVD 367 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 38.7 bits (86), Expect = 0.002 Identities = 35/154 (22%), Positives = 62/154 (40%), Gaps = 8/154 (5%) Frame = +3 Query: 12 ILVMANNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDR---KLFVGGLSWET 182 I + + + DITT + G G + PG ++ ++F+G + + Sbjct: 111 IKALLDRTGYTLDITTGQRKYGGPPPGW-------EGKPPGTGSEKVCSQVFIGKVPRDC 163 Query: 183 TDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 362 + EL F G I + DP +G ++GFAF F + + ++NK++ Sbjct: 164 FEDELIPVFEECGHIYDFRLMIDPISGLTKGFAFCTFSNKDEAQNAV----KKLDNKEIR 219 Query: 363 PKK-----AKARHGKIFVGGLSSEISDDEIRNFF 449 P K + ++FVG + S EI F Sbjct: 220 PGKRLGVCISVANSRLFVGSIPKTKSKQEILEEF 253 >SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 871 Score = 38.7 bits (86), Expect = 0.002 Identities = 18/52 (34%), Positives = 28/52 (53%) Frame = +3 Query: 153 LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 308 LFVG L +E T+ + D YG IE + + TG S+G+ F+ + E+ Sbjct: 115 LFVGNLPFEFTETQFGDLMSPYGNIERLFLVRSEVTGDSKGYGFVEYATREN 166 Score = 35.1 bits (77), Expect = 0.027 Identities = 23/82 (28%), Positives = 38/82 (46%), Gaps = 1/82 (1%) Frame = +3 Query: 147 RKLFVGGLSWETTDKEL-RDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 323 R LFV L + + L ++ F G + V +P G SRGFAF+ + E +K Sbjct: 205 RTLFVDRLPRDFKNGGLIKELFSQTGNVTFAQVAINPANGGSRGFAFVDYATAEEAEK-- 262 Query: 324 AAGEHTINNKKVDPKKAKARHG 389 G+ N ++V+ + +G Sbjct: 263 --GQRAHNGRQVEGSNIRVAYG 282 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 37.5 bits (83), Expect = 0.005 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = +3 Query: 228 ESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 323 E++N+ TD TGR RGF F+ F + E ++K + Sbjct: 123 EAVNIITDRETGRPRGFGFVTFGSKEEMEKAI 154 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 37.5 bits (83), Expect = 0.005 Identities = 16/55 (29%), Positives = 31/55 (56%) Frame = +3 Query: 144 DRKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPES 308 + + ++G LS+ ++ L + F ++ + V TD TGR RGF F+ +A ++ Sbjct: 81 EHRCYIGNLSYSVDEQALEEKFHDCNVVD-VRVITDRETGRPRGFGFVTLEAKKT 134 >SB_52510| Best HMM Match : RRM_1 (HMM E-Value=8.1e-21) Length = 304 Score = 37.1 bits (82), Expect = 0.007 Identities = 20/57 (35%), Positives = 31/57 (54%) Frame = +3 Query: 123 EAPGRDDDRKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 293 + G+ + + V LS ET + +L++ F G I I + D T +S+GFAFI F Sbjct: 173 DGSGQHETATIRVTNLSEETRESDLQELFRPLGPISRIFLAKDKFTNQSKGFAFINF 229 >SB_46435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 558 Score = 36.7 bits (81), Expect = 0.009 Identities = 23/72 (31%), Positives = 33/72 (45%), Gaps = 6/72 (8%) Frame = +3 Query: 126 APGRDD---DRKLFVGGLSWETTDKELRDHFGAYGEIESINVK---TDPNTGRSRGFAFI 287 AP DD +RKL++G L ++ + +GEIE PN G RG+ F+ Sbjct: 377 APEIDDAVSERKLWIGNLDKRLSEFNILKILQQFGEIEHFQFLFHGNGPNRGEPRGYCFV 436 Query: 288 VFKAPESIDKVM 323 FK E K + Sbjct: 437 EFKKKEDARKAL 448 >SB_57661| Best HMM Match : RRM_1 (HMM E-Value=0.017) Length = 255 Score = 35.5 bits (78), Expect = 0.020 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = +3 Query: 141 DDRKLFVGGLSWETTDKELRDHFGAYGEIESINV 242 DDRKLFVG +S +++LR F +G IE + V Sbjct: 212 DDRKLFVGMISKHAKEEDLRVMFSPFGTIEELTV 245 Score = 31.9 bits (69), Expect = 0.25 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +3 Query: 114 NSAEAPGRDDDR-KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSR 272 N RD + KLFVG + +K+LR F YG+I + + D TG+ + Sbjct: 158 NGGTTSVRDSNSVKLFVGQVPRTWEEKDLRPIFEPYGQIYELTILKDKYTGQHK 211 >SB_18026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 621 Score = 35.5 bits (78), Expect = 0.020 Identities = 22/91 (24%), Positives = 41/91 (45%), Gaps = 6/91 (6%) Frame = +3 Query: 108 DHNSAEAPGRDDDRK----LFVGGLSWETTDKELRDHFGAY--GEIESINVKTDPNTGRS 269 DHNS D + + GL +E++ ++L F I+ + K+ N G++ Sbjct: 316 DHNSDNGSNSQDQEATSTIVRMFGLPFESSKRDLYKFFNGLKIASIDLLKHKSGKNQGKN 375 Query: 270 RGFAFIVFKAPESIDKVMAAGEHTINNKKVD 362 G AF+VFK+ K + I ++ ++ Sbjct: 376 TGVAFVVFKSNNDASKALKMDRSYIGHRYIE 406 >SB_57434| Best HMM Match : LRR_1 (HMM E-Value=3.9e-13) Length = 337 Score = 34.3 bits (75), Expect = 0.047 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +3 Query: 144 DRKLFVGGLSWETTDKELRDHFGAYGEIESINVKT 248 DR +FVG L K L+ +F YGE+ES+ ++ Sbjct: 20 DRTVFVGNLPLTLKKKALKKYFSKYGEVESVRFRS 54 >SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) Length = 171 Score = 34.3 bits (75), Expect = 0.047 Identities = 24/108 (22%), Positives = 49/108 (45%), Gaps = 4/108 (3%) Frame = +3 Query: 27 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDRK----LFVGGLSWETTDKE 194 N+ N +DI L+ + + + +D P D+D +++G + + E Sbjct: 57 NSVNTTKDINATLALDSDKQK---EFEDKVKKIKPKGDEDELSPGVIYLGHIPHGFFENE 113 Query: 195 LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEH 338 ++ F +G + I + + RS+G+AF+ F A + + K+ A H Sbjct: 114 IKKFFEQFGTVNRIRLSRSKKSARSKGYAFVEF-ACDEVAKIAADTMH 160 >SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28) Length = 440 Score = 33.9 bits (74), Expect = 0.062 Identities = 25/91 (27%), Positives = 47/91 (51%), Gaps = 2/91 (2%) Frame = +3 Query: 150 KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 329 K++ G L T+K+L + +G++ ++ K G+A++VFK + D+ +AA Sbjct: 4 KVYCGRLPATATEKDLENLVKVFGKVREVDFK--------EGYAYVVFKENKDADRAVAA 55 Query: 330 -GEHTINNKKVDPKKAK-ARHGKIFVGGLSS 416 + K+ +KAK R+G VGG ++ Sbjct: 56 LNNSEFHGAKILMEKAKEMRNG---VGGYTA 83 >SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 828 Score = 33.9 bits (74), Expect = 0.062 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 2/57 (3%) Frame = +3 Query: 129 PGRDDDR--KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 293 PG D+ + L+V + + + E R F AYG I + + D +TG +G F+++ Sbjct: 125 PGGDNTKGANLYVCNIPKQLPEAEFRKAFEAYGNIVNCRLLRDKSTGLPKGCGFVLY 181 Score = 30.3 bits (65), Expect = 0.77 Identities = 25/105 (23%), Positives = 42/105 (40%), Gaps = 6/105 (5%) Frame = +3 Query: 153 LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM-AA 329 L V + + TD+ R F A + + + +G S GF F+ + E K + Sbjct: 49 LIVNYIPQDMTDQTFRMMFEAVASLNNCKIVRHKPSGWSYGFGFVDYNTTEDAQKAIDKL 108 Query: 330 GEHTINNK--KV---DPKKAKARHGKIFVGGLSSEISDDEIRNFF 449 TI NK KV P + ++V + ++ + E R F Sbjct: 109 NGFTIGNKVLKVAFSRPGGDNTKGANLYVCNIPKQLPEAEFRKAF 153 >SB_47831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.9 bits (74), Expect = 0.062 Identities = 14/42 (33%), Positives = 25/42 (59%) Frame = +3 Query: 150 KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRG 275 K+FVG + ++ +EL+D FG +G++ + D RS+G Sbjct: 80 KVFVGNIGFKVRARELKDFFGYFGDVVYAQIIMDRVKKRSKG 121 >SB_56343| Best HMM Match : RRM_1 (HMM E-Value=3.2e-14) Length = 273 Score = 33.1 bits (72), Expect = 0.11 Identities = 20/88 (22%), Positives = 38/88 (43%) Frame = +3 Query: 99 DSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGF 278 +++D + E G+ LFVG L ++ T +++ DHF G S + T S+G Sbjct: 58 ETEDVITKEQDGKKQRYILFVGNLPFDLTTEKVLDHFRCAGS-SSFRLLTKKTDNSSKGC 116 Query: 279 AFIVFKAPESIDKVMAAGEHTINNKKVD 362 F+ K + + +K++ Sbjct: 117 GFLEIDDSIGYTKALNLHHSYLGGRKIN 144 >SB_11682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 33.1 bits (72), Expect = 0.11 Identities = 16/53 (30%), Positives = 29/53 (54%) Frame = +3 Query: 135 RDDDRKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVF 293 R + K+++G L + +E+ + FG YG ++ + V +P GFAF +F Sbjct: 28 RAEMTKVYIGSLGDNASKREIENEFGYYGPLKDVWVARNP-----PGFAFCIF 75 >SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1208 Score = 33.1 bits (72), Expect = 0.11 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +3 Query: 216 YGEIESINVKTDPNTGRSRGFAFIVFKAPES 308 YGEI ++N+ D TG+ +GF F+ ++ S Sbjct: 2 YGEIVNVNLVRDKKTGKQKGFCFLCYEDQRS 32 >SB_47564| Best HMM Match : RRM_1 (HMM E-Value=0.23) Length = 44 Score = 33.1 bits (72), Expect = 0.11 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +3 Query: 216 YGEIESINVKTDPNTGRSRGFAFIVFKAPES 308 YGEI ++N+ D TG+ +GF F+ ++ S Sbjct: 2 YGEIVNVNLVRDKKTGKQKGFCFLCYEDQRS 32 >SB_35697| Best HMM Match : RRM_1 (HMM E-Value=1.3e-19) Length = 168 Score = 32.3 bits (70), Expect = 0.19 Identities = 19/70 (27%), Positives = 38/70 (54%) Frame = +3 Query: 150 KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 329 ++FVG + + + EL F G I + + D N G++RG+AF+V+ + + + + Sbjct: 75 EVFVGKIPRDLYEDELVPVFETAGPIYEVRLMMDFN-GQNRGYAFVVYTSKDDAKRCV-- 131 Query: 330 GEHTINNKKV 359 T+NN ++ Sbjct: 132 --KTLNNYEI 139 >SB_48994| Best HMM Match : ASC (HMM E-Value=1.3e-11) Length = 538 Score = 31.5 bits (68), Expect = 0.33 Identities = 13/48 (27%), Positives = 26/48 (54%) Frame = +3 Query: 3 LGVILVMANNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 146 LG+++ + NN+N + +N N N N ++ ++N+ + DDD Sbjct: 471 LGLVIKVNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNDDDDDDDD 518 Score = 28.7 bits (61), Expect = 2.3 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +3 Query: 9 VILVMANNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 146 VI V NN+N + +N N N N ++ ++N+ + DDD Sbjct: 474 VIKVNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNDDDDDDDDD 519 Score = 26.6 bits (56), Expect = 9.5 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +3 Query: 27 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 146 NN+N + +N N N N D D + + DDD Sbjct: 487 NNNNNNNNNNNNNNNNNNNNNNNNDDDDDDDDDDDDDDDD 526 >SB_11300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1148 Score = 31.5 bits (68), Expect = 0.33 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = +3 Query: 147 RKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESID 314 R +F+GGL + + + F GEI SI + +R F + F A ES+D Sbjct: 351 RTVFIGGLPESINEHIINEIFYVCGEITSIRISKGKGE-NARKFCHLRFGAKESVD 405 >SB_41412| Best HMM Match : RRM_1 (HMM E-Value=2.9e-35) Length = 1118 Score = 31.1 bits (67), Expect = 0.44 Identities = 11/34 (32%), Positives = 23/34 (67%) Frame = +3 Query: 150 KLFVGGLSWETTDKELRDHFGAYGEIESINVKTD 251 ++++G L + TT+ ++R F +YG + IN+K + Sbjct: 4 RVYLGRLPYGTTEDDVRRFFRSYGRLRDINLKNN 37 >SB_23537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 31.1 bits (67), Expect = 0.44 Identities = 23/87 (26%), Positives = 38/87 (43%), Gaps = 8/87 (9%) Frame = +3 Query: 141 DDRKLFVGGLSWETTDKELRDHFGAYG-EIESINVKTDPNTG-------RSRGFAFIVFK 296 D K++ G L ++ T EL+ F A + + + +P RSRGF F+ F Sbjct: 48 DPNKVYAGNLPFKLTQDELKAVFEAESLTVTDVLIVKEPRNEFYQQQEPRSRGFGFVTFA 107 Query: 297 APESIDKVMAAGEHTINNKKVDPKKAK 377 PE + ++N K+V + K Sbjct: 108 NPEDAQTAV----KSLNGKEVQGRTLK 130 >SB_2941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 31.1 bits (67), Expect = 0.44 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 4/68 (5%) Frame = +3 Query: 18 VMANNDNFAQDITTDNQLNGNAE----NGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETT 185 V +ND D D+++NG + N GGD D + + DDD + G S++ Sbjct: 55 VHIDNDGGDDDDDDDDEVNGGNDDDDFNNGGDCDDDDDDDDDDDDDDDDINKKGASYDDD 114 Query: 186 DKELRDHF 209 D + D + Sbjct: 115 DDDDDDGY 122 >SB_41060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 30.7 bits (66), Expect = 0.58 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +3 Query: 30 NDNFAQDITTDNQLNGNAENGGGDSQDH-NSAEAPGRDDD 146 ND+ DI D+ NGN + G D+ D N E G DDD Sbjct: 20 NDDDGDDIDDDDG-NGNGNDNGDDNDDDDNDDEGNGDDDD 58 >SB_20581| Best HMM Match : RRM_1 (HMM E-Value=1.7e-07) Length = 97 Score = 30.7 bits (66), Expect = 0.58 Identities = 20/63 (31%), Positives = 28/63 (44%) Frame = +3 Query: 189 KELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPK 368 +++R F YG IE + V D T +RG ++ F S +A E N DPK Sbjct: 37 EDIRSAFEQYGTIEDVWVVKDKATKENRGVCYVKFVKASS--AALACEEMDGRNIGDDPK 94 Query: 369 KAK 377 K Sbjct: 95 PIK 97 >SB_11425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 339 Score = 30.7 bits (66), Expect = 0.58 Identities = 23/71 (32%), Positives = 38/71 (53%), Gaps = 1/71 (1%) Frame = +3 Query: 153 LFVGGLSWETTDKE-LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 329 L+VGGL+ T +E L + FG +GEIE I + N AF+ +K+ ++ A Sbjct: 249 LYVGGLTLHTKLEEWLWEEFGEWGEIEDIRIIPKKN------IAFVRYKS--RLNAEFAK 300 Query: 330 GEHTINNKKVD 362 G+ +++ VD Sbjct: 301 GDCSLSGAIVD 311 >SB_28070| Best HMM Match : RRM_1 (HMM E-Value=1.3e-07) Length = 694 Score = 30.7 bits (66), Expect = 0.58 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +3 Query: 153 LFVGGLSWETTDKELRDHFGAYGEIESINVKTD 251 L V GLS TT+++LR F YG +E+I + D Sbjct: 183 LGVFGLSLYTTERDLRPVFEKYGPVEAIQIVYD 215 >SB_19711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 30.7 bits (66), Expect = 0.58 Identities = 20/68 (29%), Positives = 31/68 (45%) Frame = +3 Query: 90 GGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRS 269 GGG N + G+D L + L +K+L++ YG + N++ D N G S Sbjct: 104 GGGGGGMENDVASDGKD----LIIQNLPKGIQEKDLKELLQLYGNVLVCNIERDSN-GDS 158 Query: 270 RGFAFIVF 293 G A + F Sbjct: 159 SGSALVRF 166 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 30.7 bits (66), Expect = 0.58 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +3 Query: 132 GRDDDRKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRG 275 G R++ GL+ K L++ YG I++I V DP T +RG Sbjct: 135 GTPPQREVLFSGLNDNVDKKFLQEICQKYGTIQTIKVYYDPQTKNTRG 182 >SB_25551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 0.77 Identities = 13/46 (28%), Positives = 23/46 (50%) Frame = +3 Query: 9 VILVMANNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 146 +++V+ +D+ D D+ + +GGGD D + G DDD Sbjct: 97 LLIVIDGDDDGDDDDDDDDDDDDGGGDGGGDGDDDDDGNGDGGDDD 142 Score = 26.6 bits (56), Expect = 9.5 Identities = 13/47 (27%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +3 Query: 9 VILVMANNDNFAQDITTDNQLNGNAENGG-GDSQDHNSAEAPGRDDD 146 +I++ ++D D D+ +G + GG GD D + + DDD Sbjct: 98 LIVIDGDDDGDDDDDDDDDDDDGGGDGGGDGDDDDDGNGDGGDDDDD 144 >SB_24418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 705 Score = 30.3 bits (65), Expect = 0.77 Identities = 16/59 (27%), Positives = 30/59 (50%), Gaps = 8/59 (13%) Frame = +3 Query: 27 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKL--------FVGGLSWE 179 NN+N D +DN + N++N ++ D+N+ R D ++ ++ GL+WE Sbjct: 613 NNNNNNNDNNSDNNSDNNSDNNSDNNSDNNNDNNSERGADPEIKRGKNPEGWIRGLNWE 671 Score = 27.9 bits (59), Expect = 4.1 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +3 Query: 27 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 146 NNDN + + +N N N N ++ D+NS + D Sbjct: 597 NNDNNSDNNNNNNNNNNNNNNNNDNNSDNNSDNNSDNNSD 636 Score = 27.1 bits (57), Expect = 7.2 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +3 Query: 27 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 146 NNDN + + +N N N N ++ D+NS + D Sbjct: 593 NNDNNNDNNSDNNNNNNNNNNNNNNNNDNNSDNNSDNNSD 632 Score = 27.1 bits (57), Expect = 7.2 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +3 Query: 27 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDR 149 NN+N + DN + N++N ++ D+NS + +R Sbjct: 609 NNNNNNNNNNNDNNSDNNSDNNSDNNSDNNSDNNNDNNSER 649 >SB_38604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 281 Score = 29.9 bits (64), Expect = 1.0 Identities = 17/72 (23%), Positives = 29/72 (40%) Frame = +3 Query: 30 NDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHF 209 +DN D + N + +GG D D++S E DRK W + + Sbjct: 117 DDNGEDDYDGNGDNNNDDNDGGDDDNDYDSNETMAFKKDRK------GWNNNGDDNENDT 170 Query: 210 GAYGEIESINVK 245 GE + +++K Sbjct: 171 NTTGECDDVHIK 182 >SB_28750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 29.9 bits (64), Expect = 1.0 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +3 Query: 27 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 146 NN+N + +N N N N ++ D NS E DDD Sbjct: 18 NNNNNNNNNNNNNNNNNNNNNNNNNNNDDNSDEDDDDDDD 57 Score = 27.1 bits (57), Expect = 7.2 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = +3 Query: 27 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 146 NN+N + +N N N N ++ ++N+ + DDD Sbjct: 14 NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNDDNSDEDDD 53 Score = 27.1 bits (57), Expect = 7.2 Identities = 12/40 (30%), Positives = 18/40 (45%) Frame = +3 Query: 27 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 146 NN+N + +N N N N D+ D + + DDD Sbjct: 22 NNNNNNNNNNNNNNNNNNNNNNNDDNSDEDDDDDDDDDDD 61 >SB_3920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 634 Score = 29.9 bits (64), Expect = 1.0 Identities = 13/46 (28%), Positives = 21/46 (45%) Frame = +3 Query: 9 VILVMANNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 146 +I++ NN+N + +N N N N D D + + DDD Sbjct: 160 IIIINNNNNNNNNNNNNNNNNNNNNNNNNNDDDDDDDDDDDDDDDD 205 Score = 27.1 bits (57), Expect = 7.2 Identities = 13/46 (28%), Positives = 20/46 (43%) Frame = +3 Query: 9 VILVMANNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 146 +I+ NN+N + +N N N N D D + + DDD Sbjct: 161 IIINNNNNNNNNNNNNNNNNNNNNNNNNNDDDDDDDDDDDDDDDDD 206 >SB_12089| Best HMM Match : RRM_1 (HMM E-Value=7.4e-13) Length = 260 Score = 29.5 bits (63), Expect = 1.3 Identities = 25/113 (22%), Positives = 47/113 (41%) Frame = +3 Query: 87 NGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGR 266 +GG S ++ + P ++L V + + D +LR FG++G I + + + G Sbjct: 53 DGGSPSAENGDSSGP-----KRLHVTNIPFRFRDNDLRQMFGSFGVIADVEIIYN-ERGS 106 Query: 267 SRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEIS 425 F P ++ ++ G T N + KA+ + V G E+S Sbjct: 107 KHAVRFPTRPNPLNL-RIEGFGFVTFNT-AAEANKAREKLNGTIVDGRKVEVS 157 >SB_8368| Best HMM Match : VWA (HMM E-Value=0) Length = 771 Score = 29.5 bits (63), Expect = 1.3 Identities = 22/73 (30%), Positives = 34/73 (46%), Gaps = 4/73 (5%) Frame = +3 Query: 153 LFVGGLSWETTDKELRDHFGAY--GEIESINVKTDPNTGR-SRGFAFIVFKAPESIDKVM 323 LF + +TD ++ HF Y E+ ++N+K D + R RG FI S +K+ Sbjct: 167 LFYARIVMYSTDASVKMHFNKYSGAEMNNVNIKRDIDELRLERGLTFIDKALKISAEKLF 226 Query: 324 A-AGEHTINNKKV 359 +N KKV Sbjct: 227 TEKNGMRLNRKKV 239 >SB_46941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 29.5 bits (63), Expect = 1.3 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +3 Query: 27 NNDNFAQDITTDNQLNGNAE-NGGGDSQDHNS 119 NND+ D T D+ N N + NGGG D+N+ Sbjct: 193 NNDDDDDDDTDDDDHNNNDDDNGGGGDDDNNN 224 Score = 27.5 bits (58), Expect = 5.4 Identities = 13/40 (32%), Positives = 16/40 (40%) Frame = +3 Query: 27 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 146 NN N TT+N N N N D D + +DD Sbjct: 173 NNINTTTTTTTNNNNNNNNNNNDDDDDDDTDDDDHNNNDD 212 >SB_13046| Best HMM Match : La (HMM E-Value=5e-23) Length = 442 Score = 29.5 bits (63), Expect = 1.3 Identities = 13/59 (22%), Positives = 30/59 (50%) Frame = +3 Query: 195 LRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKK 371 L+ F +G++ +++ + G +GFAFI F++ + + V+ KK + ++ Sbjct: 104 LKKVFSEFGKVLYVSLPRFKHNGEIKGFAFIEFESKQQAEHVVQMFNRESKTKKEEKRE 162 >SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33) Length = 662 Score = 23.8 bits (49), Expect(2) = 1.7 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +3 Query: 141 DDRKLFVGGLSWETTDKELRDHFGAYGEIESI 236 D ++F+G L D ++ + F YG I I Sbjct: 355 DSHQVFIGNLPSGVKDADVNEVFSKYGTILEI 386 Score = 23.8 bits (49), Expect(2) = 1.7 Identities = 6/26 (23%), Positives = 17/26 (65%) Frame = +3 Query: 270 RGFAFIVFKAPESIDKVMAAGEHTIN 347 + F F++F + E + +++A +H ++ Sbjct: 425 KNFGFVIFSSAEPVQQILANKKHFLS 450 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 29.1 bits (62), Expect = 1.8 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +3 Query: 30 NDNFAQDITTDNQLN-GNAENGGGDSQDHNS 119 +DNF DI+ D LN G A N + ++NS Sbjct: 335 HDNFNDDISNDGNLNGGGANNNNNKNNNYNS 365 >SB_15012| Best HMM Match : zf-CCHC (HMM E-Value=1.1e-05) Length = 410 Score = 29.1 bits (62), Expect = 1.8 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = +3 Query: 108 DHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAYGE 224 DH AP +L V GL WE D++L YGE Sbjct: 69 DHLLQVAPAEVSRARLQVHGLPWEVPDEDLVALLSPYGE 107 >SB_51896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 29.1 bits (62), Expect = 1.8 Identities = 18/58 (31%), Positives = 31/58 (53%) Frame = +3 Query: 150 KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 323 +LFVG LS ET ++L + F YG++ ++KT + FI ++ P ++ M Sbjct: 7 QLFVGRLSKETKLRDLENVFYLYGKLLRCDLKT--------AYGFIEYEDPRDAEEAM 56 >SB_34062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 552 Score = 29.1 bits (62), Expect = 1.8 Identities = 16/63 (25%), Positives = 34/63 (53%), Gaps = 2/63 (3%) Frame = +3 Query: 147 RKLFVGGLSWETTDKELRDHFGAYGE--IESINVKTDPNTGRSRGFAFIVFKAPESIDKV 320 RK+FVGGL + + E+ F +G ++ + + +G+AF+++ S+ K+ Sbjct: 344 RKVFVGGLPPDIDEDEIHASFCRFGSLTVDWPHKAESKSYFPPKGYAFLLYLEEISVQKL 403 Query: 321 MAA 329 ++A Sbjct: 404 ISA 406 Score = 27.5 bits (58), Expect = 5.4 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = +3 Query: 300 PESI-DKVMAAGEHTIN-NKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFF 449 PE++ D+++ + ++N + D + K+FVGGL +I +DEI F Sbjct: 313 PENLADQIVPSLASSLNCSPNSDSEHIPRFSRKVFVGGLPPDIDEDEIHASF 364 >SB_14704| Best HMM Match : Mak16 (HMM E-Value=9.3) Length = 189 Score = 29.1 bits (62), Expect = 1.8 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +3 Query: 27 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 146 NN+N +I +N N N N ++ ++N+ + DDD Sbjct: 112 NNNNNNNNINNNNNNNNNNNNNNNNNNNNNNNDDDDDDDD 151 >SB_1073| Best HMM Match : Ribosomal_L12 (HMM E-Value=2.2) Length = 244 Score = 29.1 bits (62), Expect = 1.8 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +3 Query: 24 ANNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 146 A N+ +A+ +T +N N N N ++ ++N+ DDD Sbjct: 160 AINEKYAKIMTDNNNNNNNNNNNNNNNNNNNNNNNNNNDDD 200 >SB_39378| Best HMM Match : VWA (HMM E-Value=0) Length = 2865 Score = 28.7 bits (61), Expect = 2.3 Identities = 17/54 (31%), Positives = 30/54 (55%) Frame = +3 Query: 87 NGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAYGEIESINVKT 248 NGG + D + A R++ +LFV GL E ++ +LR+ + I+ + +KT Sbjct: 603 NGGKSTDDASDAAYELRNEGVELFVVGLGDENSEAQLRE-IASVPVIDHVFMKT 655 >SB_2375| Best HMM Match : Pentapeptide_2 (HMM E-Value=2.7) Length = 521 Score = 28.7 bits (61), Expect = 2.3 Identities = 23/83 (27%), Positives = 33/83 (39%), Gaps = 1/83 (1%) Frame = +3 Query: 24 ANNDNFAQDITTDNQLNGNAENGGGD-SQDHNSAEAPGRDDDRKLFVGGLSWETTDKELR 200 +N+DN D +T N N N EN D S +NS + DD K + +D Sbjct: 289 SNSDNSNTDNSTSN--NSNPENSTSDNSNSNNSNQDNSNSDDSKPDNSNTNNSNSDNSNS 346 Query: 201 DHFGAYGEIESINVKTDPNTGRS 269 D+ + +PNT S Sbjct: 347 DNSTSDNSNPDNLTSDNPNTDNS 369 Score = 27.9 bits (59), Expect = 4.1 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +3 Query: 24 ANNDNFAQDITTDNQLNGNAENGGGD-SQDHNSAEAPGRDDDRK 152 +N+DN D +T N N N EN D S +NS + DD K Sbjct: 103 SNSDNSNTDNSTSN--NSNPENSTSDNSNSNNSNQDNSNSDDSK 144 >SB_55491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 28.3 bits (60), Expect = 3.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +3 Query: 27 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 146 ++DN D DN NG+ ++ D D + +A DDD Sbjct: 61 DSDNNYDDNDDDNDDNGDDDDNDDDDDDDDDDDADDDDDD 100 >SB_50597| Best HMM Match : 7tm_1 (HMM E-Value=2.59941e-42) Length = 347 Score = 28.3 bits (60), Expect = 3.1 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 3/79 (3%) Frame = -2 Query: 296 LKHNEGKPS*SACVWICLYINT---LYFTVCSKMITELLICGLPAQPTNKKFSVVIASWG 126 LK GK + A +W+ Y++ + F + + + LIC LP P+N F ++ + Sbjct: 140 LKARGGKLT-IALIWVLTYLSVGFPMAFYMELTKVDDRLIC-LPKWPSNIVFKILTCFFI 197 Query: 125 LSTVMILRITATVLCISIK 69 ++ L ITA I IK Sbjct: 198 SLIIIPLCITAVAYIIMIK 216 >SB_44482| Best HMM Match : RRM_1 (HMM E-Value=0.19) Length = 486 Score = 28.3 bits (60), Expect = 3.1 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +3 Query: 108 DHNSAEAPGRDDDRKLFVGGLSWETTDKELRDHFGAYGEIESINV 242 D + EA R++ R ++VG +S ET ++ F YG IE + V Sbjct: 358 DRSFREA-SREERRIVYVGKISDETHKDDVWRRFRKYGPIEKVTV 401 >SB_24568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1109 Score = 28.3 bits (60), Expect = 3.1 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +3 Query: 33 DNFAQDITTDNQLNGNAENGG-GDSQDHNSAEAPGRDDD 146 D + D D+ + + +N G GD D+ AE G DDD Sbjct: 821 DYYYDDDDDDDDDDDDGDNDGDGDGDDYGDAENYGEDDD 859 >SB_18084| Best HMM Match : DUF801 (HMM E-Value=0.37) Length = 599 Score = 28.3 bits (60), Expect = 3.1 Identities = 9/30 (30%), Positives = 22/30 (73%) Frame = +3 Query: 30 NDNFAQDITTDNQLNGNAENGGGDSQDHNS 119 ND+ A D++ ++ + G+ +NGG D+ ++++ Sbjct: 180 NDDSASDVSIEDIIYGDDDNGGDDNDNYDN 209 >SB_42035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 415 Score = 28.3 bits (60), Expect = 3.1 Identities = 12/29 (41%), Positives = 20/29 (68%) Frame = -2 Query: 149 SVVIASWGLSTVMILRITATVLCISIKLV 63 ++++ S G++ L ITAT+LC SI L+ Sbjct: 267 TILLESSGVTLPKALHITATILCYSISLL 295 >SB_7529| Best HMM Match : Toxin_29 (HMM E-Value=0.0017) Length = 691 Score = 28.3 bits (60), Expect = 3.1 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +3 Query: 27 NNDNFAQDITTDNQLNGNAENGGGDSQD 110 +++++A D DN +NG+ ++GGGD D Sbjct: 585 DDEDYAGD--GDNDVNGDGDSGGGDDDD 610 >SB_56987| Best HMM Match : Cornifin (HMM E-Value=1.5) Length = 752 Score = 27.9 bits (59), Expect = 4.1 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +3 Query: 102 SQDHNSAEAPGRDD-DRKLFVGGLSWETTDKELRDHFGAYGEI 227 S DHN +PG DD +R++ L ++ + E+R Y EI Sbjct: 113 SPDHNDLTSPGHDDNEREVIQDSLPIDSPENEVRLAAVLYTEI 155 >SB_41149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 27.9 bits (59), Expect = 4.1 Identities = 21/85 (24%), Positives = 45/85 (52%), Gaps = 6/85 (7%) Frame = +3 Query: 147 RKLFVGGLSWETTDKELRDHFG--AYGEIES---INVKTDPNTGRSRGFAFIVFKAPESI 311 ++ +VG LS + T ++L HFG A + S + + + +G+S GF F+ P+ + Sbjct: 5 KRFYVGNLSVKATREDLSHHFGLDATPYLRSSCWVELAVE-KSGKSLGFGFV--NVPKHL 61 Query: 312 -DKVMAAGEHTINNKKVDPKKAKAR 383 D +M + + +K++ + A+ + Sbjct: 62 ADHLMHLNQTKLFDKRITIEPARGK 86 >SB_46960| Best HMM Match : Neuromodulin (HMM E-Value=3.6) Length = 557 Score = 27.9 bits (59), Expect = 4.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +3 Query: 27 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 146 +N+N +DI N EN GG+S + N + DD+ Sbjct: 147 SNNNEDEDIQEVEDDNEGKENDGGESDEENDDDDEDGDDE 186 >SB_23339| Best HMM Match : I-set (HMM E-Value=1.3e-07) Length = 423 Score = 27.9 bits (59), Expect = 4.1 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Frame = +3 Query: 9 VILVMANNDNFAQDITT---DNQLNGNAENGGGDSQDHNSAEAPGRDDD 146 +++VM +DN D DN + +A+N D D+N+ + G DD Sbjct: 5 IMMVMMRDDNNGNDDENNYNDNHNDKDADNKNNDDGDNNNNDKCGYKDD 53 >SB_20267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 415 Score = 27.9 bits (59), Expect = 4.1 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = +3 Query: 12 ILVMANNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 146 IL NNDN+ + DN N N N D+ D+N + DD Sbjct: 140 ILCNDNNDNYDNNDNNDNNDN-NDNNDNYDNNDNNDNDNNDNYDD 183 Score = 26.6 bits (56), Expect = 9.5 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 27 NNDNFAQDITTDNQLNG-NAENGGGDSQDHNSAEAPGRDDD 146 NNDN+ + T DN N N +N + D+N ++D Sbjct: 195 NNDNYDNNGTNDNNDNNYNYDNNDNNDNDNNDNNDKNDNND 235 >SB_20263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 27.9 bits (59), Expect = 4.1 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +3 Query: 27 NNDNFAQDITTDNQLNGN--AENGGGDSQDHN 116 NNDN+ + DN N N NG DS D+N Sbjct: 90 NNDNYDNNGNNDNNDNYNNYDNNGNNDSNDNN 121 >SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1309 Score = 27.9 bits (59), Expect = 4.1 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +3 Query: 234 INVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEH-TINNKKV 359 + V DP +S+GF F+ F E K +A + TI K+V Sbjct: 542 VRVVKDPAKNKSKGFGFVSFVRREDAAKAIAEMDSVTIGGKQV 584 Score = 27.5 bits (58), Expect = 5.4 Identities = 18/66 (27%), Positives = 29/66 (43%) Frame = +3 Query: 153 LFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 332 ++VG L + D EL+ F YG I V D +G+AFI + + + + + Sbjct: 617 VYVGNLPPDVKDYELQQMFSQYGSILETKVFAD------KGYAFINARGEKRRQRCLTSS 670 Query: 333 EHTINN 350 NN Sbjct: 671 RRHGNN 676 >SB_1065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 27.9 bits (59), Expect = 4.1 Identities = 22/79 (27%), Positives = 32/79 (40%), Gaps = 1/79 (1%) Frame = +3 Query: 36 NFAQDITTDNQLNGNAENGGGDSQDHNSAE-APGRDDDRKLFVGGLSWETTDKELRDHFG 212 N+ DI D+ N N +N D DH E DDD + + + T ++ RD Sbjct: 51 NYDDDIDDDDYDNDN-DNYDDDDDDHKYEEDDDDDDDDDDMMMVMMMIHTGHQQHRDRQE 109 Query: 213 AYGEIESINVKTDPNTGRS 269 +G E N D N + Sbjct: 110 DHGVQEDPNNDNDNNNNNN 128 >SB_38223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 27.5 bits (58), Expect = 5.4 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -1 Query: 189 YLWSPSSAHQQKVFCRHRVLGPQH 118 YLW+PS Q +V R+R G H Sbjct: 143 YLWTPSGLSQSQVRSRNRANGTTH 166 >SB_56231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 383 Score = 27.5 bits (58), Expect = 5.4 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +3 Query: 27 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGG 167 ++D D D+ + G+ ++ GD D + + G DDD + GG Sbjct: 248 DDDGEVDDAGGDDGVGGDNDDDRGDDGDDDEDDDRGNDDDEDDWGGG 294 >SB_43316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 27.5 bits (58), Expect = 5.4 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -1 Query: 261 LCLDLSLH*YSLFHRMLQNDHGAPYLWSPSSAHQQKV 151 L +D LH Y F+R L D+ A Y W S +++V Sbjct: 153 LIVDTGLH-YQGFNRSLALDYFAKYAWDTSDGAEKEV 188 >SB_39141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 27.5 bits (58), Expect = 5.4 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +3 Query: 27 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 146 NN+N + +N N N N D D + + DDD Sbjct: 87 NNNNNNNNNNNNNNNNNNNNNNNNDDDDDDDDDDDDNDDD 126 Score = 26.6 bits (56), Expect = 9.5 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +3 Query: 27 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 146 NN+N + +N N N N D D + + DDD Sbjct: 88 NNNNNNNNNNNNNNNNNNNNNNNDDDDDDDDDDDDNDDDD 127 >SB_20262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 27.5 bits (58), Expect = 5.4 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = +3 Query: 27 NNDNFAQDITTDNQLNGN--AENGGGDSQDHN 116 NNDN+ + DN N + NG DS D+N Sbjct: 192 NNDNYDNNDNNDNNDNNDNYDNNGNNDSNDNN 223 Score = 26.6 bits (56), Expect = 9.5 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = +3 Query: 27 NNDNFAQDITTDNQLN--GNAENGGGDSQDHN 116 NNDN + DN N N NG D+ D+N Sbjct: 96 NNDNNGNNDNNDNNDNNDNNDNNGNNDNNDNN 127 >SB_19847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 27.5 bits (58), Expect = 5.4 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 60 DNQLNGNAENGGGDSQDHNSAEAPGRDDD 146 DN + + ++GGGD D N + G DDD Sbjct: 92 DNDDSNDVDDGGGDGDDDNDGD--GVDDD 118 >SB_15580| Best HMM Match : Pentapeptide (HMM E-Value=0.2) Length = 610 Score = 27.5 bits (58), Expect = 5.4 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 24 ANNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEA 128 ANN N A + N N NA N ++ + N+A A Sbjct: 254 ANNANNANNANNANANNANANNANANNANANNANA 288 >SB_37378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 781 Score = 27.1 bits (57), Expect = 7.2 Identities = 14/50 (28%), Positives = 29/50 (58%) Frame = +3 Query: 150 KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIVFKA 299 +LFV +S T +++ F ++ ++K + NTG S+GFA++ + + Sbjct: 204 RLFVI-ISTAVTQEQVVRLFDIIPGMQVCDLKRNYNTGESKGFAYVTYNS 252 >SB_23644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 27.1 bits (57), Expect = 7.2 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = +3 Query: 27 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDD 143 +NDN D N N+ +G +S D N + G D+ Sbjct: 19 DNDNSGDDNDNSGDDNDNSGDGNDNSGDGNDSNGDGNDN 57 >SB_14896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 27.1 bits (57), Expect = 7.2 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +3 Query: 15 LVMANNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 146 LV+ ++D+ D D+ G+ + G GD D N + G DDD Sbjct: 70 LVIKDDDDDDGDDDDDDDY-GDDDYGDGDDDDDNGDDDGGDDDD 112 >SB_4594| Best HMM Match : K_tetra (HMM E-Value=5.6e-24) Length = 303 Score = 27.1 bits (57), Expect = 7.2 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +3 Query: 138 DDDRKLFVGGLSWETTDKELRDHFGAYGEIESIN 239 +++ K FVG + D+ +H G+YG I +N Sbjct: 179 EENLKAFVGPGFNDLKDEPAENHMGSYGSINELN 212 >SB_4001| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0056) Length = 508 Score = 27.1 bits (57), Expect = 7.2 Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 36 NFAQDITTDNQLNGNAE-NGGGDSQDHNSAEAPGRDD 143 ++ D D+ NG+ + +GGGD D + ++ G DD Sbjct: 441 DYDSDGDGDDDDNGDGDVDGGGDGDDDDDSDGDGDDD 477 >SB_54036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 27.1 bits (57), Expect = 7.2 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +3 Query: 27 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 146 NN+N +I +N N N N ++ ++N+ DDD Sbjct: 64 NNNNNNNNIKNNNNNNNNNNNKNNNNNNNNNNNNDDDDDD 103 >SB_28695| Best HMM Match : Ras (HMM E-Value=0) Length = 1058 Score = 27.1 bits (57), Expect = 7.2 Identities = 10/33 (30%), Positives = 21/33 (63%) Frame = +3 Query: 27 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAE 125 N+D+ + DN + +A +GGGD+ D++ ++ Sbjct: 802 NDDDDDDNGDADNGRDNDAHDGGGDNSDYDGSD 834 >SB_23204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 27.1 bits (57), Expect = 7.2 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 84 ENGGGDSQDHNSAEAPGRDDDRK 152 +N GGD D++ + DDD K Sbjct: 8 DNDGGDDDDNDDVDGDNNDDDHK 30 >SB_23116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 325 Score = 27.1 bits (57), Expect = 7.2 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +3 Query: 27 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 146 NNDN ++ +N + N +N D D N+ DDD Sbjct: 119 NNDNNNKNNNNNNDDDDNNKNDNDDDYDDNNNNNDDYDDD 158 >SB_58045| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 1752 Score = 26.6 bits (56), Expect = 9.5 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = -2 Query: 254 WICLYINTLYFTVCSKMITELLICGLPAQPTNKKFSVVIAS 132 W+CL+ + TVCS+ + + + G+ A PT + +AS Sbjct: 163 WMCLFPSARR-TVCSRKSSAVTLMGIAAGPTKCQQEQSVAS 202 >SB_53221| Best HMM Match : zf-CCHC (HMM E-Value=0.061) Length = 410 Score = 26.6 bits (56), Expect = 9.5 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +3 Query: 150 KLFVGGLSWETTDKELRDHFGAYGEIESINVKTDP 254 +L V GL WE D++L YGE ++ + DP Sbjct: 191 RLQVHGLPWEVPDEDLVALLSPYGEGIVVSREKDP 225 >SB_23047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1601 Score = 26.6 bits (56), Expect = 9.5 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +3 Query: 60 DNQLNGNAENGGGDSQDHNSAEAPGRDDDRK 152 D ++ +ENG G+SQ+ NSA+A + +K Sbjct: 640 DFKIMTESENGEGNSQESNSAKADNQTAGQK 670 >SB_22347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 327 Score = 26.6 bits (56), Expect = 9.5 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +3 Query: 42 AQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFV 161 AQ + Q NG A GG DH + P R DRK F+ Sbjct: 273 AQALILFLQGNGYAVQGG-KGMDHEPEKWPSRSTDRKSFL 311 >SB_21913| Best HMM Match : C2 (HMM E-Value=0.31) Length = 987 Score = 26.6 bits (56), Expect = 9.5 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +3 Query: 33 DNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 146 DN D D+ NG+ +NG D+ D ++ + DDD Sbjct: 727 DNDGDDDNGDDD-NGDDDNGDDDNGDDDNGDDDNGDDD 763 >SB_13452| Best HMM Match : Mak16 (HMM E-Value=2.6) Length = 163 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +3 Query: 54 TTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 146 TT+N N N+ N ++ ++N+ + DDD Sbjct: 101 TTNNNNNNNSNNNNNNNNNNNNNDDDDDDDD 131 >SB_3425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 304 Score = 26.6 bits (56), Expect = 9.5 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = +3 Query: 27 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDR 149 N+D+ D D+ +G + GGG D N + P + R Sbjct: 113 NDDDGGGDDDDDDDDDGGGDGGGGRDDDENDDKEPRKTGRR 153 >SB_44810| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 26.6 bits (56), Expect = 9.5 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +3 Query: 60 DNQLNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGG 167 + Q+NG+ + GGGDS DH E D VGG Sbjct: 2 NKQINGDNDGGGGDS-DHGVEEDDEDDGCSDDGVGG 36 >SB_35887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 983 Score = 26.6 bits (56), Expect = 9.5 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +3 Query: 51 ITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 146 + +D+ +GN ++ G D D N + G DDD Sbjct: 4 VDSDDDDDGNDDDNGNDDDDGND-DGDGNDDD 34 >SB_23753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 517 Score = 26.6 bits (56), Expect = 9.5 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 14/77 (18%) Frame = +3 Query: 135 RDDDRKLFVGGLSWETTDKELRDHFGAYGEIESINVKTDP-----------NTGRS-RGF 278 R D+ LFV + T ++ FG G ++S+ + P NT +GF Sbjct: 38 RPSDKTLFVINVPPYCTKLAIKKLFGKCGGVKSVYLHKQPGKVKETKTSLLNTDNEVKGF 97 Query: 279 --AFIVFKAPESIDKVM 323 A++VFK P S+D + Sbjct: 98 KVAYVVFKKPSSLDAAL 114 >SB_21644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 787 Score = 26.6 bits (56), Expect = 9.5 Identities = 25/95 (26%), Positives = 38/95 (40%), Gaps = 1/95 (1%) Frame = +3 Query: 9 VILVMANNDNFAQDITTDNQ-LNGNAENGGGDSQDHNSAEAPGRDDDRKLFVGGLSWETT 185 +++V +N D DN + + +NGGGD+ D N DD G+ + Sbjct: 319 MVMVDGGYNNGYNDCVDDNCCVRDDDDNGGGDNDDDNDDV-----DDCGGGDAGVLISYS 373 Query: 186 DKELRDHFGAYGEIESINVKTDPNTGRSRGFAFIV 290 D D F G + V+ D T F F+V Sbjct: 374 DCGDDDDFDCDGGYDDCGVRDDDGTEMFVTFVFLV 408 >SB_20991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 26.6 bits (56), Expect = 9.5 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +3 Query: 27 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 146 NN+N + +N N N ++ D D N+ + DDD Sbjct: 11 NNNNNNNNNNNNNNNNNNDDDDDDDDDDDNNDDDDDDDDD 50 >SB_11641| Best HMM Match : 7tm_1 (HMM E-Value=2.1e-33) Length = 390 Score = 26.6 bits (56), Expect = 9.5 Identities = 14/50 (28%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = -2 Query: 179 LPAQPTNKKFSVVIASWGLSTVMILRITATVLCISIKLVVGGNIL-CKII 33 +PA N S + ++ + VM+L I +LC+ + + N L C++I Sbjct: 12 MPAGAKNSVGSTIASACFIVIVMLLTIMGNLLCVLLSPIEKSNKLPCRVI 61 >SB_3318| Best HMM Match : Xan_ur_permease (HMM E-Value=7.20267e-43) Length = 774 Score = 26.6 bits (56), Expect = 9.5 Identities = 12/40 (30%), Positives = 18/40 (45%) Frame = +3 Query: 27 NNDNFAQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 146 NN+N + +N N N N D ++A+ DDD Sbjct: 591 NNNNNNNNNNNNNNNNNNNNNNNNADDDDDAADDDDADDD 630 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,865,490 Number of Sequences: 59808 Number of extensions: 318868 Number of successful extensions: 2526 Number of sequences better than 10.0: 131 Number of HSP's better than 10.0 without gapping: 1104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2291 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 896151577 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -