BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0810 (450 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 25 0.29 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 24 0.67 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 23 1.5 EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate c... 21 6.2 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 21 6.2 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 25.4 bits (53), Expect = 0.29 Identities = 9/17 (52%), Positives = 15/17 (88%) Frame = -3 Query: 334 SPAAMTLSIDSGALNTM 284 SPA ++S+DSG++NT+ Sbjct: 555 SPAIESISVDSGSINTV 571 Score = 21.4 bits (43), Expect = 4.7 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = +3 Query: 51 ITTDNQLNGNAENGGGDSQDHNSAEA 128 +T+ + +N N+ NG +S +S+ A Sbjct: 532 LTSSSNVNNNSGNGNTNSSARDSSPA 557 Score = 20.6 bits (41), Expect = 8.2 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +3 Query: 177 ETTDKELRDHFGAYGEIESINVKTDP 254 E+ DKE H G ++ ++ +TDP Sbjct: 694 ESDDKEGYLHSVVSGALDRLHYETDP 719 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 24.2 bits (50), Expect = 0.67 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 45 QDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDDRK 152 Q+ N N NA N D+Q+ N ++D+R+ Sbjct: 430 QNADNQNADNQNANNQNADNQNANKQNGNRQNDNRQ 465 Score = 23.8 bits (49), Expect = 0.88 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +3 Query: 60 DNQLNGNAENGGGDSQDHNSAEAPGRDDDRK 152 DN+ NGN +N G+ Q+ N ++D+++ Sbjct: 487 DNKQNGNRQN--GNKQNDNKQNGNRQNDNKR 515 Score = 23.0 bits (47), Expect = 1.5 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 60 DNQLNGNAENGGGDSQDHNS 119 DN+ NGN +N ++Q+ N+ Sbjct: 512 DNKRNGNRQNDNQNNQNDNN 531 Score = 22.2 bits (45), Expect = 2.7 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = +3 Query: 63 NQLNGNAENGGGDSQDHNSAEAPGRDDDRK 152 N N NA+N D+Q+ N+ A ++ +++ Sbjct: 426 NAGNQNADNQNADNQNANNQNADNQNANKQ 455 Score = 21.4 bits (43), Expect = 4.7 Identities = 8/29 (27%), Positives = 15/29 (51%) Frame = +3 Query: 63 NQLNGNAENGGGDSQDHNSAEAPGRDDDR 149 N+ N N NG + + N+ R+D++ Sbjct: 508 NRQNDNKRNGNRQNDNQNNQNDNNRNDNQ 536 Score = 21.4 bits (43), Expect = 4.7 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +3 Query: 60 DNQLNGNAENGGGDSQDHNSAE 125 DNQ N N +N D+Q H+S++ Sbjct: 522 DNQNNQN-DNNRNDNQVHHSSK 542 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 23.0 bits (47), Expect = 1.5 Identities = 13/44 (29%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +3 Query: 18 VMANNDNF-AQDITTDNQLNGNAENGGGDSQDHNSAEAPGRDDD 146 + A N N A + +N N N NG D+ + N A + D Sbjct: 228 ITAGNANTNASNNNNNNNNNNNNNNGANDNGNGNGASNNNNNGD 271 >EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate carboxykinase protein. Length = 118 Score = 21.0 bits (42), Expect = 6.2 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = +3 Query: 162 GGLSWETTDKELRD 203 GG+ WE +KE+ D Sbjct: 100 GGIFWEGLEKEVGD 113 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 21.0 bits (42), Expect = 6.2 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 224 FTVCSKMITELLICGLPAQPTNKK 153 FT+ S + T +++C PA N K Sbjct: 493 FTIASIVGTFIILCEAPALRDNTK 516 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,037 Number of Sequences: 438 Number of extensions: 2684 Number of successful extensions: 18 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11820384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -