BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0809 (645 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory pro... 24 0.93 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 23 1.6 X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 22 3.8 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 22 3.8 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 22 5.0 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 21 8.7 >DQ855505-1|ABH88192.1| 119|Tribolium castaneum chemosensory protein 19 protein. Length = 119 Score = 24.2 bits (50), Expect = 0.93 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +2 Query: 377 RCSRKAQAMRKKVRHFM 427 +CS K + M KKV HF+ Sbjct: 72 KCSEKQKEMTKKVIHFL 88 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 23.4 bits (48), Expect = 1.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -1 Query: 567 TASTGCWFVFKD 532 TAST CW VF D Sbjct: 529 TASTRCWEVFMD 540 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 22.2 bits (45), Expect = 3.8 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = -3 Query: 460 RSVARTVLSPQHKMPDLLPHRLSFPAAAILWSQTLYLRFSF 338 +SVA T S H++ D L +A +SQT+ + F Sbjct: 168 QSVASTASSADHQIVDRLLSHAPIDSANQWYSQTIDNSYQF 208 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 22.2 bits (45), Expect = 3.8 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = -3 Query: 460 RSVARTVLSPQHKMPDLLPHRLSFPAAAILWSQTLYLRFSF 338 +SVA T S H++ D L +A +SQT+ + F Sbjct: 159 QSVASTASSADHQIVDRLLSHAPIDSANQWYSQTIDNSYQF 199 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.8 bits (44), Expect = 5.0 Identities = 10/28 (35%), Positives = 14/28 (50%), Gaps = 2/28 (7%) Frame = -3 Query: 478 CLY--WALRSVARTVLSPQHKMPDLLPH 401 C Y W+ V +P+H +PDL H Sbjct: 91 CYYTNWSQYRVKIGKFTPEHIIPDLCTH 118 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 21.0 bits (42), Expect = 8.7 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +1 Query: 121 DVTGADEDRSKF 156 D+T +D DRSK+ Sbjct: 59 DITTSDRDRSKY 70 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.314 0.129 0.368 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,991 Number of Sequences: 336 Number of extensions: 2590 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16552695 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -