BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0809 (645 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024089-4|AAK09073.2| 239|Caenorhabditis elegans Hypothetical ... 33 0.13 AL024499-1|CAB54261.2| 295|Caenorhabditis elegans Hypothetical ... 32 0.30 AF016421-7|AAO12430.1| 413|Caenorhabditis elegans Hypothetical ... 29 3.7 >AC024089-4|AAK09073.2| 239|Caenorhabditis elegans Hypothetical protein C36E6.2 protein. Length = 239 Score = 33.5 bits (73), Expect = 0.13 Identities = 14/47 (29%), Positives = 27/47 (57%), Gaps = 3/47 (6%) Frame = +1 Query: 91 NREDTLRQFCDVTGAD---EDRSKFFLESSNWQLDVALSSFYENGGN 222 +RE+ + +F ++ D + F+L+ +NW L A+S FY+ G+ Sbjct: 19 DRENLIHKFEEIISPQMIPHDLAAFYLDLANWNLSTAISVFYDQNGD 65 >AL024499-1|CAB54261.2| 295|Caenorhabditis elegans Hypothetical protein H38K22.2a protein. Length = 295 Score = 32.3 bits (70), Expect = 0.30 Identities = 13/44 (29%), Positives = 26/44 (59%) Frame = +1 Query: 82 MSANREDTLRQFCDVTGADEDRSKFFLESSNWQLDVALSSFYEN 213 + ++++ LRQF T E S FL +NW ++ A++ +++N Sbjct: 4 LKSDQKTKLRQFVQWTQVTEAVSLNFLAKANWNIEYAMTLYFDN 47 >AF016421-7|AAO12430.1| 413|Caenorhabditis elegans Hypothetical protein F44E7.5a protein. Length = 413 Score = 28.7 bits (61), Expect = 3.7 Identities = 18/49 (36%), Positives = 26/49 (53%) Frame = -3 Query: 208 HRNLKEQHLIASLRILKRIYCDLRQHR*HHKTDVMYLLYSQTW*FRIYI 62 H + KE L SLR L +C ++ + H ++ LLYS W R+YI Sbjct: 202 HTSTKEFKLPLSLRQL--FFCPKQEVKCKHAENIATLLYSANW-KRVYI 247 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.314 0.129 0.368 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,509,251 Number of Sequences: 27780 Number of extensions: 255705 Number of successful extensions: 741 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 721 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 741 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1423653030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -