BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0809 (645 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g15410.1 68417.m02355 UBX domain-containing protein low simil... 46 2e-05 At2g33010.1 68415.m04045 ubiquitin-associated (UBA)/TS-N domain-... 42 3e-04 At3g12760.1 68416.m01593 expressed protein similar to RP42 prote... 38 0.008 At4g04210.1 68417.m00597 UBX domain-containing protein similar t... 35 0.053 At2g33000.1 68415.m04044 ubiquitin-associated (UBA)/TS-N domain-... 34 0.070 At1g05040.1 68414.m00505 hypothetical protein 34 0.093 At5g63630.1 68418.m07989 DEAD box RNA helicase, putative strong ... 28 4.6 At4g10790.1 68417.m01759 UBX domain-containing protein low simil... 28 6.1 At5g26570.1 68418.m03152 glycoside hydrolase starch-binding doma... 27 8.1 At4g39450.1 68417.m05582 expressed protein 27 8.1 At1g78650.1 68414.m09166 expressed protein weak similarity to DN... 27 8.1 >At4g15410.1 68417.m02355 UBX domain-containing protein low similarity to XY40 protein [Rattus norvegicus] GI:2547025; contains Pfam profile PF00789: UBX domain Length = 421 Score = 46.4 bits (105), Expect = 2e-05 Identities = 20/51 (39%), Positives = 30/51 (58%) Frame = +1 Query: 97 EDTLRQFCDVTGADEDRSKFFLESSNWQLDVALSSFYENGGNADEAPANPT 249 E+ + F ++T + + + FFLES W LD A+S+F +N A P NPT Sbjct: 7 ENLINSFIEITSSSREEANFFLESHTWNLDAAVSTFLDNDAAAAAEP-NPT 56 >At2g33010.1 68415.m04045 ubiquitin-associated (UBA)/TS-N domain-containing protein contains Pfam profile PF00627: UBA/TS-N domain Length = 649 Score = 42.3 bits (95), Expect = 3e-04 Identities = 16/52 (30%), Positives = 28/52 (53%) Frame = +1 Query: 91 NREDTLRQFCDVTGADEDRSKFFLESSNWQLDVALSSFYENGGNADEAPANP 246 N+E+ ++QFC++ G D + +LE W L VA+ F ++ +NP Sbjct: 426 NKEEIIKQFCEIVGLHPDVAVAYLERCQWSLQVAIDYFMNEAYFTEDVTSNP 477 >At3g12760.1 68416.m01593 expressed protein similar to RP42 protein [Homo sapiens] GI:9896486; contains Pfam profile PF00627: UBA/TS-N domain, PF03556: Domain of unknown function (DUF298) Length = 250 Score = 37.5 bits (83), Expect = 0.008 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +1 Query: 82 MSANREDTLRQFCDVTGADEDRSKFFLESSNWQLDVALSSFY 207 +S + D L+QF +TGA E + L++S+W L+ A FY Sbjct: 4 LSRSNRDKLQQFVAITGASEKNALQALKASDWHLEAAFDVFY 45 >At4g04210.1 68417.m00597 UBX domain-containing protein similar to XY40 protein [Rattus norvegicus] GI:2547025; contains Pfam profile PF00789: UBX domain Length = 303 Score = 34.7 bits (76), Expect = 0.053 Identities = 21/46 (45%), Positives = 26/46 (56%) Frame = +1 Query: 421 FYAGGSERSGQQILGPSKGRKDIVSEMFKSVRERGAVVFEDEPTSS 558 +Y GG E+SG + PSK KD V E+F R+ GAV EP S Sbjct: 42 YYTGG-EKSGMLVQDPSK--KDDVDEIFNQARQLGAVEGPLEPPPS 84 >At2g33000.1 68415.m04044 ubiquitin-associated (UBA)/TS-N domain-containing protein-related contains weak hit to Pfam F00627: UBA/TS-N domain; supported by tandem duplication of ubiquitin-associated (UBA)/TS-N domain protein (GI:2924790) (TIGR_Ath1:At2g33010) [Arabidopsis thaliana] Length = 508 Score = 34.3 bits (75), Expect = 0.070 Identities = 13/39 (33%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Frame = +1 Query: 91 NREDTLRQFC-DVTGADEDRSKFFLESSNWQLDVALSSF 204 +R +++ +FC V G + ++ +LE SNW +++A+ SF Sbjct: 100 SRNESIARFCYAVAGVSVEEARAYLERSNWNINLAVDSF 138 >At1g05040.1 68414.m00505 hypothetical protein Length = 166 Score = 33.9 bits (74), Expect = 0.093 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = +1 Query: 97 EDT-LRQFCDVTGADEDRSKFFLESSNWQLDVALSSF 204 EDT + +FC T A +D + ++LE +W L+ A+S F Sbjct: 4 EDTNVTRFCKATSACKDAAFYYLEGFDWNLEDAISGF 40 >At5g63630.1 68418.m07989 DEAD box RNA helicase, putative strong similarity to RNA helicase RH25 [Arabidopsis thaliana] GI:3776023; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH31 GI:3776030 Length = 522 Score = 28.3 bits (60), Expect = 4.6 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 1/70 (1%) Frame = -3 Query: 337 FLFSGTFVPEVRRAVIPYRCLAEQRMMPHSLD*LEPHLHYHRSHRNLKEQHLIASL-RIL 161 FLFS T EVR+ CL R ++ + H +H+ +++ H+IASL R Sbjct: 244 FLFSATVPEEVRQI-----CLVALRRDHEFVNCV--HEGTIETHQQVRQMHMIASLDRHF 296 Query: 160 KRIYCDLRQH 131 +Y LR+H Sbjct: 297 SLLYTLLREH 306 >At4g10790.1 68417.m01759 UBX domain-containing protein low similarity to SP|Q9UNN5 FAS-associated factor 1 (FAF1 protein) {Homo sapiens}; contains Pfam profile PF00789: UBX domain Length = 480 Score = 27.9 bits (59), Expect = 6.1 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +1 Query: 100 DTLRQFCDVTGA-DEDRSKFFLESSNWQLDVALSSFYENGGNADEA 234 D L F +TG D D L++ W L++A+SSF + +A + Sbjct: 6 DKLGYFQAITGLEDADLCTEILQAHGWDLELAISSFTSSDQDASSS 51 >At5g26570.1 68418.m03152 glycoside hydrolase starch-binding domain-containing protein similar to SEX1 (starch excess) [Arabidopsis thaliana] GI:12044358; contains Pfam profile PF00686: Starch binding domain Length = 1191 Score = 27.5 bits (58), Expect = 8.1 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = -3 Query: 283 RCLAEQRMMPHSLD*LEPHLHYHRSHRNLKEQHLIASLRILKRI 152 R +A + +PH L H ++ HRN + LIA+ +L+RI Sbjct: 367 RDIAHRNDIPHDLKQEIKHTIQNKLHRNAGPEDLIATEAMLQRI 410 >At4g39450.1 68417.m05582 expressed protein Length = 1553 Score = 27.5 bits (58), Expect = 8.1 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 5/48 (10%) Frame = +1 Query: 160 LESSNWQLDVA----LSSFYENGGNADEAPANPTSAASF-SVLPDSDM 288 L +S ++DVA +SSFY++ GNAD A + F SV + D+ Sbjct: 159 LSASMLRIDVASLRRISSFYKSNGNADMAHQKSLKRSMFHSVSSEDDL 206 >At1g78650.1 68414.m09166 expressed protein weak similarity to DNA polymerase delta subunit 3 (DNA polymerase delta subunit p66) (Swiss-Prot:Q15054) [Homo sapiens] Length = 509 Score = 27.5 bits (58), Expect = 8.1 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +3 Query: 297 ARLTSGTKVPEKRKKENLKYKVWDHRIAAA 386 ARL S T++PE K+ N KY V + + A+ Sbjct: 74 ARLASSTELPEVEKEFNGKYSVHIYSVQAS 103 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.314 0.129 0.368 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,731,455 Number of Sequences: 28952 Number of extensions: 235385 Number of successful extensions: 680 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 665 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 680 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1334473344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -