BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0808 (365 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.16 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.22 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.50 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.50 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.50 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.66 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.66 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 0.87 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 29 0.87 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 29 0.87 SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_46672| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 29 1.2 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.0 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.0 SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) 28 2.0 SB_56291| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.0 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.0 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.0 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.0 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.0 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 28 2.0 SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.0 SB_20114| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.0 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.7 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.7 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.7 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.7 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.7 SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.7 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.7 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.7 SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.7 SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) 28 2.7 SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.7 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 27 3.5 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 27 3.5 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 27 3.5 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 27 3.5 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_35110| Best HMM Match : LRR_1 (HMM E-Value=3.9e-09) 27 3.5 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_15057| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) 27 3.5 SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) 27 3.5 SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) 27 3.5 SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_11970| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_5303| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.5 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.7 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.7 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.7 SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) 27 4.7 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.7 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.7 SB_34241| Best HMM Match : RuvA_C (HMM E-Value=1.5) 27 4.7 SB_18776| Best HMM Match : DUF765 (HMM E-Value=4) 27 4.7 SB_11588| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.7 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_30580| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_10232| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_6857| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) 27 6.2 SB_36228| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_31629| Best HMM Match : DEAD (HMM E-Value=1.2e-05) 27 6.2 SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_30117| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_19592| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_18866| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_684| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) 26 8.1 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 26 8.1 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 26 8.1 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 26 8.1 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_22912| Best HMM Match : Adeno_VII (HMM E-Value=7.6) 26 8.1 SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) 26 8.1 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 26 8.1 SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) 26 8.1 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 26 8.1 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 26 8.1 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 26 8.1 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 26 8.1 SB_3786| Best HMM Match : THAP (HMM E-Value=7.5e-07) 26 8.1 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 26 8.1 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_52591| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 26 8.1 SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 26 8.1 SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 26 8.1 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_37747| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_36996| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_33961| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_32763| Best HMM Match : Histone_HNS (HMM E-Value=0.15) 26 8.1 SB_32594| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_30669| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_30190| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_28661| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_24360| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_21002| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_19132| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 26 8.1 SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 26 8.1 SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 26 8.1 SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_897| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_175| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.1 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 31.9 bits (69), Expect = 0.16 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -1 Query: 59 LIAPRADSCSPGDPLV 12 L+AP ++SCSPGDPLV Sbjct: 17 LLAPTSNSCSPGDPLV 32 >SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.5 bits (68), Expect = 0.22 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -1 Query: 68 RRVLIAPRADSCSPGDPLV 12 RR PR++SCSPGDPLV Sbjct: 10 RRKPARPRSNSCSPGDPLV 28 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.3 bits (65), Expect = 0.50 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 50 PRADSCSPGDPLV 12 PR++SCSPGDPLV Sbjct: 2 PRSNSCSPGDPLV 14 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 30.3 bits (65), Expect = 0.50 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 50 PRADSCSPGDPLV 12 PR++SCSPGDPLV Sbjct: 21 PRSNSCSPGDPLV 33 >SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 30.3 bits (65), Expect = 0.50 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -1 Query: 50 PRADSCSPGDPLV 12 PR++SCSPGDPLV Sbjct: 68 PRSNSCSPGDPLV 80 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 29.9 bits (64), Expect = 0.66 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 62 VLIAPRADSCSPGDPLV 12 V+IA ++SCSPGDPLV Sbjct: 30 VIIASLSNSCSPGDPLV 46 >SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.9 bits (64), Expect = 0.66 Identities = 14/19 (73%), Positives = 17/19 (89%), Gaps = 1/19 (5%) Frame = -1 Query: 65 RVLIAPR-ADSCSPGDPLV 12 RV+IA R ++SCSPGDPLV Sbjct: 18 RVIIAVRRSNSCSPGDPLV 36 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.5 bits (63), Expect = 0.87 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -1 Query: 62 VLIAPRADSCSPGDPLV 12 VL P ++SCSPGDPLV Sbjct: 12 VLHVPPSNSCSPGDPLV 28 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 29.5 bits (63), Expect = 0.87 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -1 Query: 53 APRADSCSPGDPLV 12 AP ++SCSPGDPLV Sbjct: 139 APSSNSCSPGDPLV 152 >SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) Length = 923 Score = 29.5 bits (63), Expect = 0.87 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -1 Query: 68 RRVLIAPRADSCSPGDPLV 12 R +L+A ++SCSPGDPLV Sbjct: 792 RVMLVAISSNSCSPGDPLV 810 >SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 29.1 bits (62), Expect = 1.2 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +2 Query: 11 KLVDPPGCRNRHEARLGHV-SIINIYMYLYNSINSFTSL 124 +LVDPPGCRN + H+ + N ++Y+ N+ + Sbjct: 14 ELVDPPGCRNSINT-INHIYHVTNTINHIYHVTNTINHI 51 >SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.1 bits (62), Expect = 1.2 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -1 Query: 56 IAPRADSCSPGDPLV 12 I P ++SCSPGDPLV Sbjct: 17 IGPPSNSCSPGDPLV 31 >SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 29.1 bits (62), Expect = 1.2 Identities = 10/16 (62%), Positives = 15/16 (93%) Frame = -1 Query: 59 LIAPRADSCSPGDPLV 12 +++ R++SCSPGDPLV Sbjct: 554 ILSDRSNSCSPGDPLV 569 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 29.1 bits (62), Expect = 1.2 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = +2 Query: 11 KLVDPPGCRNRHEAR 55 +LVDPPGCRN +AR Sbjct: 14 ELVDPPGCRNSIQAR 28 >SB_46672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 29.1 bits (62), Expect = 1.2 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -3 Query: 63 CPNRASCRFLQPGGSTS 13 C RA FLQPGGSTS Sbjct: 37 CVQRAGIEFLQPGGSTS 53 >SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) Length = 727 Score = 29.1 bits (62), Expect = 1.2 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = -1 Query: 68 RRVLIAPRADSCSPGDPLV 12 ++ + P ++SCSPGDPLV Sbjct: 40 KKPIFKPTSNSCSPGDPLV 58 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 28.7 bits (61), Expect = 1.5 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -1 Query: 65 RVLIAPRADSCSPGDPLV 12 R +A +++SCSPGDPLV Sbjct: 17 RPSVASQSNSCSPGDPLV 34 >SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.7 bits (61), Expect = 1.5 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = -1 Query: 68 RRVLIAPRADSCSPGDPLV 12 +R+ + R++SCSPGDPLV Sbjct: 19 KRLSKSKRSNSCSPGDPLV 37 >SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.7 bits (61), Expect = 1.5 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -1 Query: 53 APRADSCSPGDPLV 12 A R++SCSPGDPLV Sbjct: 24 ATRSNSCSPGDPLV 37 >SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 28.7 bits (61), Expect = 1.5 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -1 Query: 59 LIAPRADSCSPGDPLV 12 ++ R++SCSPGDPLV Sbjct: 20 IVEKRSNSCSPGDPLV 35 >SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 28.7 bits (61), Expect = 1.5 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = -1 Query: 50 PRADSCSPGDPLV 12 P+++SCSPGDPLV Sbjct: 30 PQSNSCSPGDPLV 42 >SB_15537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.7 bits (61), Expect = 1.5 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -1 Query: 56 IAPRADSCSPGDPLV 12 ++P ++SCSPGDPLV Sbjct: 22 LSPGSNSCSPGDPLV 36 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 28.7 bits (61), Expect = 1.5 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = +2 Query: 11 KLVDPPGCRNRHEARL 58 +LVDPPGCRN ++R+ Sbjct: 77 ELVDPPGCRNSMDSRV 92 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.3 bits (60), Expect = 2.0 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -1 Query: 53 APRADSCSPGDPLV 12 A R++SCSPGDPLV Sbjct: 11 AVRSNSCSPGDPLV 24 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 28.3 bits (60), Expect = 2.0 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -1 Query: 56 IAPRADSCSPGDPLV 12 + P ++SCSPGDPLV Sbjct: 61 VQPLSNSCSPGDPLV 75 >SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) Length = 205 Score = 28.3 bits (60), Expect = 2.0 Identities = 12/15 (80%), Positives = 13/15 (86%), Gaps = 1/15 (6%) Frame = +2 Query: 11 KLVDPPGCRNR-HEA 52 +LVDPPGCRN HEA Sbjct: 14 ELVDPPGCRNSIHEA 28 >SB_56291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 434 Score = 28.3 bits (60), Expect = 2.0 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = -1 Query: 353 LMHMTGLLRSETRXSSSAHCLTTRRLFFAPRPGQQHAKQYDNRKNRSIPYDISSL 189 LMH G L +TR H + F R + K+Y ++ +PYD SL Sbjct: 206 LMHALGFLHEQTRMDRDEHITVHKDRIFPER--MLNFKKY-HQDTSGLPYDFRSL 257 >SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 28.3 bits (60), Expect = 2.0 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -1 Query: 68 RRVLIAPRADSCSPGDPLV 12 R++ I ++SCSPGDPLV Sbjct: 31 RQLSITSTSNSCSPGDPLV 49 >SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 28.3 bits (60), Expect = 2.0 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -1 Query: 65 RVLIAPRADSCSPGDPLV 12 R + R++SCSPGDPLV Sbjct: 58 RAIRLSRSNSCSPGDPLV 75 >SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 28.3 bits (60), Expect = 2.0 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -1 Query: 56 IAPRADSCSPGDPLV 12 I R++SCSPGDPLV Sbjct: 13 IPKRSNSCSPGDPLV 27 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 28.3 bits (60), Expect = 2.0 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -1 Query: 56 IAPRADSCSPGDPLV 12 I P ++SCSPGDPLV Sbjct: 56 IPPVSNSCSPGDPLV 70 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 28.3 bits (60), Expect = 2.0 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +2 Query: 11 KLVDPPGCRNRHEARLGHVSIIN 79 +LVDPPGCRN A + + SI++ Sbjct: 14 ELVDPPGCRNSMNANVSY-SIVS 35 >SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.3 bits (60), Expect = 2.0 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -1 Query: 56 IAPRADSCSPGDPLV 12 I R++SCSPGDPLV Sbjct: 22 IGHRSNSCSPGDPLV 36 >SB_20114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 28.3 bits (60), Expect = 2.0 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 65 RVLIAPRADSCSPGDPLV 12 +VL AP ++SCSPGDPLV Sbjct: 15 KVLPAP-SNSCSPGDPLV 31 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.9 bits (59), Expect = 2.7 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -1 Query: 50 PRADSCSPGDPLV 12 P ++SCSPGDPLV Sbjct: 9 PASNSCSPGDPLV 21 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.9 bits (59), Expect = 2.7 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -1 Query: 50 PRADSCSPGDPLV 12 P ++SCSPGDPLV Sbjct: 15 PTSNSCSPGDPLV 27 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.9 bits (59), Expect = 2.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 59 LIAPRADSCSPGDPLV 12 L R++SCSPGDPLV Sbjct: 25 LCRSRSNSCSPGDPLV 40 >SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 27.9 bits (59), Expect = 2.7 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -1 Query: 68 RRVLIAPRADSCSPGDPLV 12 R + A +++SCSPGDPLV Sbjct: 15 RPTIQARKSNSCSPGDPLV 33 >SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.9 bits (59), Expect = 2.7 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -1 Query: 62 VLIAPRADSCSPGDPLV 12 +LI ++SCSPGDPLV Sbjct: 14 ILIKITSNSCSPGDPLV 30 >SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.9 bits (59), Expect = 2.7 Identities = 12/17 (70%), Positives = 15/17 (88%), Gaps = 1/17 (5%) Frame = -1 Query: 59 LIAP-RADSCSPGDPLV 12 L+ P R++SCSPGDPLV Sbjct: 40 LVDPARSNSCSPGDPLV 56 >SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 27.9 bits (59), Expect = 2.7 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -1 Query: 59 LIAPRADSCSPGDPLV 12 ++ R++SCSPGDPLV Sbjct: 55 MLPRRSNSCSPGDPLV 70 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 27.9 bits (59), Expect = 2.7 Identities = 13/23 (56%), Positives = 17/23 (73%), Gaps = 4/23 (17%) Frame = -1 Query: 68 RRVLIAPRA----DSCSPGDPLV 12 R +++PRA +SCSPGDPLV Sbjct: 16 RYAILSPRARLVSNSCSPGDPLV 38 >SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.9 bits (59), Expect = 2.7 Identities = 13/21 (61%), Positives = 16/21 (76%), Gaps = 2/21 (9%) Frame = -1 Query: 68 RRVLIAP--RADSCSPGDPLV 12 RR L+ R++SCSPGDPLV Sbjct: 5 RRSLVTDEIRSNSCSPGDPLV 25 >SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) Length = 129 Score = 27.9 bits (59), Expect = 2.7 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -1 Query: 50 PRADSCSPGDPLV 12 P ++SCSPGDPLV Sbjct: 5 PTSNSCSPGDPLV 17 >SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.9 bits (59), Expect = 2.7 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -1 Query: 50 PRADSCSPGDPLV 12 P ++SCSPGDPLV Sbjct: 18 PASNSCSPGDPLV 30 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -1 Query: 50 PRADSCSPGDPLV 12 P ++SCSPGDPLV Sbjct: 182 PPSNSCSPGDPLV 194 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -1 Query: 56 IAPRADSCSPGDPLV 12 + P ++SCSPGDPLV Sbjct: 27 VYPVSNSCSPGDPLV 41 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 381 RSNSCSPGDPLV 392 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 21 RSNSCSPGDPLV 32 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 24 RSNSCSPGDPLV 35 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 10 RSNSCSPGDPLV 21 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 10 RSNSCSPGDPLV 21 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 12 RSNSCSPGDPLV 23 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 27.5 bits (58), Expect = 3.5 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 59 LIAPRADSCSPGDPLV 12 LI ++SCSPGDPLV Sbjct: 3 LIMETSNSCSPGDPLV 18 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 16 RSNSCSPGDPLV 27 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 4 RSNSCSPGDPLV 15 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 875 RSNSCSPGDPLV 886 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -1 Query: 50 PRADSCSPGDPLV 12 P ++SCSPGDPLV Sbjct: 24 PGSNSCSPGDPLV 36 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 39 RSNSCSPGDPLV 50 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 27.5 bits (58), Expect = 3.5 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -1 Query: 62 VLIAPRADSCSPGDPLV 12 +L A ++SCSPGDPLV Sbjct: 477 ILEAGASNSCSPGDPLV 493 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 27.5 bits (58), Expect = 3.5 Identities = 14/24 (58%), Positives = 15/24 (62%), Gaps = 6/24 (25%) Frame = +2 Query: 11 KLVDPPGCRN------RHEARLGH 64 +LVDPPGCRN RH AR H Sbjct: 34 ELVDPPGCRNSMPDRPRHAARPTH 57 >SB_35110| Best HMM Match : LRR_1 (HMM E-Value=3.9e-09) Length = 546 Score = 27.5 bits (58), Expect = 3.5 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -2 Query: 331 FVRKHEXPVPPIASPRGDYSSLRDRANSTPNNMT 230 +V H P+PPI++P G RD +TP N++ Sbjct: 221 YVGPHPRPLPPISAPAG---LGRDSEPATPRNLS 251 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 4 RSNSCSPGDPLV 15 >SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 66 RSNSCSPGDPLV 77 >SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -1 Query: 50 PRADSCSPGDPLV 12 P ++SCSPGDPLV Sbjct: 16 PLSNSCSPGDPLV 28 >SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 63 RSNSCSPGDPLV 74 >SB_15057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 3.5 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -2 Query: 331 FVRKHEXPVPPIASPRGDYSSLRDRANSTPNNMT 230 +V H P+PPI++P G RD +TP N++ Sbjct: 28 YVGPHPRPLPPISAPAG---LGRDSEPATPRNLS 58 >SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 16 RSNSCSPGDPLV 27 >SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.5 bits (58), Expect = 3.5 Identities = 13/20 (65%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = -1 Query: 68 RRVLIAPRA-DSCSPGDPLV 12 R + PRA +SCSPGDPLV Sbjct: 2 RPCVTMPRASNSCSPGDPLV 21 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 15 RSNSCSPGDPLV 26 >SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 8 RSNSCSPGDPLV 19 >SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 5 RSNSCSPGDPLV 16 >SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 110 RSNSCSPGDPLV 121 >SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 31 RSNSCSPGDPLV 42 >SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 15 RSNSCSPGDPLV 26 >SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 6 RSNSCSPGDPLV 17 >SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 8 RSNSCSPGDPLV 19 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -1 Query: 56 IAPRADSCSPGDPLV 12 + P ++SCSPGDPLV Sbjct: 61 LRPVSNSCSPGDPLV 75 >SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -1 Query: 50 PRADSCSPGDPLV 12 P ++SCSPGDPLV Sbjct: 39 PPSNSCSPGDPLV 51 >SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 92 RSNSCSPGDPLV 103 >SB_50750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 20 RSNSCSPGDPLV 31 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.5 bits (58), Expect = 3.5 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -1 Query: 68 RRVLIAPRADSCSPGDPLV 12 RR ++ ++SCSPGDPLV Sbjct: 27 RRYRVSLISNSCSPGDPLV 45 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 54 RSNSCSPGDPLV 65 >SB_48557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 7 RSNSCSPGDPLV 18 >SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 10 RSNSCSPGDPLV 21 >SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 29 RSNSCSPGDPLV 40 >SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 44 RSNSCSPGDPLV 55 >SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 11 RSNSCSPGDPLV 22 >SB_38642| Best HMM Match : IF4E (HMM E-Value=9.7e-12) Length = 263 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -1 Query: 50 PRADSCSPGDPLV 12 P ++SCSPGDPLV Sbjct: 138 PGSNSCSPGDPLV 150 >SB_35501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 17 RSNSCSPGDPLV 28 >SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 322 RSNSCSPGDPLV 333 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 16 RSNSCSPGDPLV 27 >SB_30823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 60 RSNSCSPGDPLV 71 >SB_30677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 5 RSNSCSPGDPLV 16 >SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 7 RSNSCSPGDPLV 18 >SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 14 RSNSCSPGDPLV 25 >SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 7 RSNSCSPGDPLV 18 >SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 8 RSNSCSPGDPLV 19 >SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 27.5 bits (58), Expect = 3.5 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 3/35 (8%) Frame = +2 Query: 11 KLVDPPGCRNRHEA-RLG--HVSIINIYMYLYNSI 106 +LVDPPGCRN E G + II+ Y+ L+ ++ Sbjct: 14 ELVDPPGCRNSMEMYTFGTQYWMIISSYVILFPAV 48 Score = 26.2 bits (55), Expect = 8.1 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -1 Query: 62 VLIAPRADSCSPGDPLV 12 + I ++SCSPGDPLV Sbjct: 83 LFIIQTSNSCSPGDPLV 99 >SB_18474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 12 RSNSCSPGDPLV 23 >SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -1 Query: 50 PRADSCSPGDPLV 12 P ++SCSPGDPLV Sbjct: 71 PPSNSCSPGDPLV 83 >SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 55 RSNSCSPGDPLV 66 >SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) Length = 221 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -1 Query: 50 PRADSCSPGDPLV 12 P ++SCSPGDPLV Sbjct: 96 PPSNSCSPGDPLV 108 >SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 139 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 59 LIAPRADSCSPGDPLV 12 L+ ++SCSPGDPLV Sbjct: 11 LVTASSNSCSPGDPLV 26 >SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 54 RSNSCSPGDPLV 65 >SB_13994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 3 RSNSCSPGDPLV 14 >SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 31 RSNSCSPGDPLV 42 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 214 RSNSCSPGDPLV 225 >SB_11970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -1 Query: 50 PRADSCSPGDPLV 12 P ++SCSPGDPLV Sbjct: 11 PGSNSCSPGDPLV 23 >SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 8 RSNSCSPGDPLV 19 >SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 19 RSNSCSPGDPLV 30 >SB_5303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 1 RSNSCSPGDPLV 12 >SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 5 RSNSCSPGDPLV 16 >SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 27.5 bits (58), Expect = 3.5 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -1 Query: 62 VLIAPRADSCSPGDPLV 12 VL+ ++SCSPGDPLV Sbjct: 41 VLVIGISNSCSPGDPLV 57 >SB_3973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 5 RSNSCSPGDPLV 16 >SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 35 RSNSCSPGDPLV 46 >SB_1405| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.5 bits (58), Expect = 3.5 Identities = 10/12 (83%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 R++SCSPGDPLV Sbjct: 21 RSNSCSPGDPLV 32 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 27.1 bits (57), Expect = 4.7 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +2 Query: 11 KLVDPPGCRNRHE 49 +LVDPPGCRN E Sbjct: 14 ELVDPPGCRNSME 26 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 27.1 bits (57), Expect = 4.7 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 11 KLVDPPGCRNRHEARLGHVSIINIYM 88 +LVDPPGCRN ++ SI +Y+ Sbjct: 14 ELVDPPGCRNSIVTKVHGNSIEVLYV 39 >SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 27.1 bits (57), Expect = 4.7 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = -1 Query: 56 IAPRADSCSPGDPLV 12 + +++SCSPGDPLV Sbjct: 68 VVQKSNSCSPGDPLV 82 >SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) Length = 106 Score = 27.1 bits (57), Expect = 4.7 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +2 Query: 11 KLVDPPGCRNRHEAR 55 +LVDPPGCRN + R Sbjct: 14 ELVDPPGCRNSMKQR 28 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.1 bits (57), Expect = 4.7 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -1 Query: 50 PRADSCSPGDPLV 12 P ++SCSPGDPLV Sbjct: 2 PVSNSCSPGDPLV 14 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 27.1 bits (57), Expect = 4.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 11 KLVDPPGCRNRHEARLGHVSIINIY 85 +LVDPPGCRN E +++ +Y Sbjct: 14 ELVDPPGCRNSIEGCNRNLTSAGLY 38 >SB_34241| Best HMM Match : RuvA_C (HMM E-Value=1.5) Length = 274 Score = 27.1 bits (57), Expect = 4.7 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -1 Query: 56 IAPRADSCSPGDPLV 12 +A ++SCSPGDPLV Sbjct: 147 VANSSNSCSPGDPLV 161 >SB_18776| Best HMM Match : DUF765 (HMM E-Value=4) Length = 134 Score = 27.1 bits (57), Expect = 4.7 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -1 Query: 59 LIAPRADSCSPGDPLV 12 +I+ ++SCSPGDPLV Sbjct: 6 VISKTSNSCSPGDPLV 21 >SB_11588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.1 bits (57), Expect = 4.7 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 59 LIAPRADSCSPGDPLV 12 L+ ++SCSPGDPLV Sbjct: 10 LVIKTSNSCSPGDPLV 25 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 26.6 bits (56), Expect = 6.2 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -1 Query: 65 RVLIAPRADSCSPGDPLV 12 R+ +++SCSPGDPLV Sbjct: 5 RMKTREKSNSCSPGDPLV 22 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 26.6 bits (56), Expect = 6.2 Identities = 11/16 (68%), Positives = 14/16 (87%), Gaps = 1/16 (6%) Frame = -1 Query: 56 IAPR-ADSCSPGDPLV 12 + PR ++SCSPGDPLV Sbjct: 22 LVPRPSNSCSPGDPLV 37 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 26.6 bits (56), Expect = 6.2 Identities = 9/15 (60%), Positives = 14/15 (93%) Frame = -1 Query: 56 IAPRADSCSPGDPLV 12 ++ +++SCSPGDPLV Sbjct: 3 LSTQSNSCSPGDPLV 17 >SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 26.6 bits (56), Expect = 6.2 Identities = 11/15 (73%), Positives = 13/15 (86%), Gaps = 1/15 (6%) Frame = +2 Query: 11 KLVDPPGCRNR-HEA 52 +LVDPPGCRN H+A Sbjct: 14 ELVDPPGCRNSIHKA 28 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 26.6 bits (56), Expect = 6.2 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -1 Query: 56 IAPRADSCSPGDPLV 12 I+ ++SCSPGDPLV Sbjct: 31 ISKTSNSCSPGDPLV 45 >SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 26.6 bits (56), Expect = 6.2 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -1 Query: 62 VLIAPRADSCSPGDPLV 12 ++I ++SCSPGDPLV Sbjct: 75 IIIWAGSNSCSPGDPLV 91 >SB_30580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 26.6 bits (56), Expect = 6.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -3 Query: 57 NRASCRFLQPGGSTS 13 NR FLQPGGSTS Sbjct: 38 NRPDIEFLQPGGSTS 52 >SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 26.6 bits (56), Expect = 6.2 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = +2 Query: 11 KLVDPPGCRNRHEAR 55 +LVDPPGCRN + R Sbjct: 14 ELVDPPGCRNSIDNR 28 >SB_20330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 26.6 bits (56), Expect = 6.2 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 54 RASCRFLQPGGSTS 13 R+S FLQPGGSTS Sbjct: 14 RSSIEFLQPGGSTS 27 >SB_10232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 26.6 bits (56), Expect = 6.2 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -3 Query: 66 TCPNRASCRFLQPGGSTS 13 T + S FLQPGGSTS Sbjct: 2 TAAQKTSIEFLQPGGSTS 19 >SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 26.6 bits (56), Expect = 6.2 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -1 Query: 59 LIAPRADSCSPGDPLV 12 +I+ ++SCSPGDPLV Sbjct: 7 VISELSNSCSPGDPLV 22 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 26.6 bits (56), Expect = 6.2 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +2 Query: 11 KLVDPPGCRNRHE 49 +LVDPPGCRN E Sbjct: 14 ELVDPPGCRNSIE 26 >SB_6857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 26.6 bits (56), Expect = 6.2 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 54 RASCRFLQPGGSTS 13 RA+ FLQPGGSTS Sbjct: 40 RANIEFLQPGGSTS 53 >SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) Length = 123 Score = 26.6 bits (56), Expect = 6.2 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +2 Query: 11 KLVDPPGCRNRHE 49 +LVDPPGCRN E Sbjct: 14 ELVDPPGCRNSIE 26 >SB_36228| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 26.6 bits (56), Expect = 6.2 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -1 Query: 62 VLIAPRADSCSPGDPLV 12 VL ++SCSPGDPLV Sbjct: 7 VLTVGGSNSCSPGDPLV 23 >SB_31629| Best HMM Match : DEAD (HMM E-Value=1.2e-05) Length = 415 Score = 26.6 bits (56), Expect = 6.2 Identities = 9/11 (81%), Positives = 11/11 (100%) Frame = +2 Query: 8 SKLVDPPGCRN 40 ++LVDPPGCRN Sbjct: 318 TELVDPPGCRN 328 >SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 26.6 bits (56), Expect = 6.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -1 Query: 53 APRADSCSPGDPLV 12 A ++SCSPGDPLV Sbjct: 70 ATESNSCSPGDPLV 83 >SB_30117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 26.6 bits (56), Expect = 6.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -1 Query: 53 APRADSCSPGDPLV 12 A ++SCSPGDPLV Sbjct: 26 AKESNSCSPGDPLV 39 >SB_19592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 26.6 bits (56), Expect = 6.2 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -1 Query: 62 VLIAPRADSCSPGDPLV 12 + I ++SCSPGDPLV Sbjct: 8 IYILDTSNSCSPGDPLV 24 >SB_18866| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 26.6 bits (56), Expect = 6.2 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 54 RASCRFLQPGGSTS 13 R+S FLQPGGSTS Sbjct: 9 RSSIEFLQPGGSTS 22 >SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 26.6 bits (56), Expect = 6.2 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -1 Query: 68 RRVLIAPRADSCSPGDPLV 12 RRV + ++SCSPGDPLV Sbjct: 46 RRVYVT--SNSCSPGDPLV 62 >SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 26.6 bits (56), Expect = 6.2 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -1 Query: 56 IAPRADSCSPGDPLV 12 I+ ++SCSPGDPLV Sbjct: 13 ISQTSNSCSPGDPLV 27 >SB_684| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 695 Score = 26.6 bits (56), Expect = 6.2 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -2 Query: 325 RKHEXPVPPIASPRGDYSSLRDRA 254 + HE VPP A+P G SSL+D A Sbjct: 628 KMHEPSVPPTAAP-GTLSSLKDYA 650 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 26.2 bits (55), Expect = 8.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 Query: 56 IAPRADSCSPGDPLV 12 I ++SCSPGDPLV Sbjct: 6 ITTTSNSCSPGDPLV 20 >SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) Length = 171 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 26.2 bits (55), Expect = 8.1 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 54 RASCRFLQPGGSTS 13 RA FLQPGGSTS Sbjct: 66 RAGIEFLQPGGSTS 79 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = -1 Query: 62 VLIAPRADSCSPGDPLV 12 +++ ++SCSPGDPLV Sbjct: 6 IVLTVGSNSCSPGDPLV 22 >SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 90 ELVDPPGCRN 99 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 658 ELVDPPGCRN 667 >SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 26.2 bits (55), Expect = 8.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 Query: 56 IAPRADSCSPGDPLV 12 I ++SCSPGDPLV Sbjct: 13 IGKTSNSCSPGDPLV 27 >SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_22912| Best HMM Match : Adeno_VII (HMM E-Value=7.6) Length = 136 Score = 26.2 bits (55), Expect = 8.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 66 TCPNRASCRFLQPGGSTS 13 T R FLQPGGSTS Sbjct: 7 TATRRTDIEFLQPGGSTS 24 >SB_22864| Best HMM Match : Adeno_VII (HMM E-Value=7.5) Length = 169 Score = 26.2 bits (55), Expect = 8.1 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -3 Query: 54 RASCRFLQPGGSTS 13 RA FLQPGGSTS Sbjct: 43 RAQIEFLQPGGSTS 56 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) Length = 182 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 31 ELVDPPGCRN 40 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 71 ELVDPPGCRN 80 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) Length = 129 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -1 Query: 59 LIAPRADSCSPGDPLV 12 ++ ++SCSPGDPLV Sbjct: 1 MVTSPSNSCSPGDPLV 16 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_3786| Best HMM Match : THAP (HMM E-Value=7.5e-07) Length = 807 Score = 26.2 bits (55), Expect = 8.1 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -1 Query: 269 APRPGQQHAKQYDNRKNRSIPYDISS 192 +P P +Q Q DN++ R + Y I+S Sbjct: 579 SPSPNEQQVIQEDNKRQRRLAYIINS 604 >SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 26.2 bits (55), Expect = 8.1 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -1 Query: 56 IAPRADSCSPGDPLV 12 I +++SCSPGDPLV Sbjct: 21 IIRQSNSCSPGDPLV 35 >SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 26.2 bits (55), Expect = 8.1 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 4/21 (19%) Frame = -1 Query: 62 VLIAPRA----DSCSPGDPLV 12 +LI P A +SCSPGDPLV Sbjct: 26 LLIVPNATAQSNSCSPGDPLV 46 >SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) Length = 214 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 +++SCSPGDPLV Sbjct: 188 KSNSCSPGDPLV 199 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 +++SCSPGDPLV Sbjct: 21 KSNSCSPGDPLV 32 >SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 69 ELVDPPGCRN 78 >SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 26.2 bits (55), Expect = 8.1 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -1 Query: 53 APRADSCSPGDPLV 12 A ++SCSPGDPLV Sbjct: 2 AATSNSCSPGDPLV 15 >SB_53121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 26.2 bits (55), Expect = 8.1 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 63 CPNRASCRFLQPGGSTS 13 C N FLQPGGSTS Sbjct: 59 CGNGQRIEFLQPGGSTS 75 >SB_52591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 26.2 bits (55), Expect = 8.1 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -3 Query: 57 NRASCRFLQPGGSTS 13 NR FLQPGGSTS Sbjct: 5 NRGIIEFLQPGGSTS 19 >SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 26.2 bits (55), Expect = 8.1 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -1 Query: 62 VLIAPRADSCSPGDPLV 12 V++ ++SCSPGDPLV Sbjct: 21 VIMRITSNSCSPGDPLV 37 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 26.2 bits (55), Expect = 8.1 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -1 Query: 62 VLIAPRADSCSPGDPLV 12 ++I ++SCSPGDPLV Sbjct: 3 MMIVVVSNSCSPGDPLV 19 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 26.2 bits (55), Expect = 8.1 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -1 Query: 62 VLIAPRADSCSPGDPLV 12 + IA ++SCSPGDPLV Sbjct: 14 ISIAFVSNSCSPGDPLV 30 >SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 +++SCSPGDPLV Sbjct: 20 KSNSCSPGDPLV 31 >SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) Length = 213 Score = 26.2 bits (55), Expect = 8.1 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -1 Query: 68 RRVLIAPRADSCSPGDPLV 12 R ++ ++SCSPGDPLV Sbjct: 110 RALVSKAESNSCSPGDPLV 128 >SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 26.2 bits (55), Expect = 8.1 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -1 Query: 53 APRADSCSPGDPLV 12 A ++SCSPGDPLV Sbjct: 4 ASSSNSCSPGDPLV 17 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 31 ELVDPPGCRN 40 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 26.2 bits (55), Expect = 8.1 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -1 Query: 62 VLIAPRADSCSPGDPLV 12 + I ++SCSPGDPLV Sbjct: 57 LFIITTSNSCSPGDPLV 73 >SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 26.2 bits (55), Expect = 8.1 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 59 LIAPRADSCSPGDPLV 12 LI ++SCSPGDPLV Sbjct: 8 LIPMVSNSCSPGDPLV 23 >SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 +++SCSPGDPLV Sbjct: 14 KSNSCSPGDPLV 25 >SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) Length = 171 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_37747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 +++SCSPGDPLV Sbjct: 5 KSNSCSPGDPLV 16 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 51 ELVDPPGCRN 60 >SB_36996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 +++SCSPGDPLV Sbjct: 3 KSNSCSPGDPLV 14 >SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_33961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 26.2 bits (55), Expect = 8.1 Identities = 15/29 (51%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = +3 Query: 12 N*WIPRAAGIGTRRD*DTSQLLIY-ICTY 95 N WIPRAAGI + TS ++I +CTY Sbjct: 1 NSWIPRAAGIRS----PTSDVIIQSLCTY 25 >SB_32763| Best HMM Match : Histone_HNS (HMM E-Value=0.15) Length = 481 Score = 26.2 bits (55), Expect = 8.1 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -1 Query: 53 APRADSCSPGDPLV 12 A ++SCSPGDPLV Sbjct: 355 ASASNSCSPGDPLV 368 >SB_32594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 +++SCSPGDPLV Sbjct: 3 KSNSCSPGDPLV 14 >SB_30669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 26.2 bits (55), Expect = 8.1 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -1 Query: 65 RVLIAPRADSCSPGDPLV 12 R+ ++SCSPGDPLV Sbjct: 5 RIARVDASNSCSPGDPLV 22 >SB_30190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 26.2 bits (55), Expect = 8.1 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -1 Query: 65 RVLIAPRADSCSPGDPLV 12 +V + ++SCSPGDPLV Sbjct: 22 KVEVQKGSNSCSPGDPLV 39 >SB_28661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 +++SCSPGDPLV Sbjct: 11 KSNSCSPGDPLV 22 >SB_24360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 +++SCSPGDPLV Sbjct: 4 KSNSCSPGDPLV 15 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 26.2 bits (55), Expect = 8.1 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -1 Query: 62 VLIAPRADSCSPGDPLV 12 + I ++SCSPGDPLV Sbjct: 29 ICICTVSNSCSPGDPLV 45 >SB_21002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 26.2 bits (55), Expect = 8.1 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 66 TCPNRASCRFLQPGGSTS 13 TC FLQPGGSTS Sbjct: 5 TCEAAIQIEFLQPGGSTS 22 >SB_19132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 +++SCSPGDPLV Sbjct: 18 KSNSCSPGDPLV 29 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 26.2 bits (55), Expect = 8.1 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -1 Query: 59 LIAPRADSCSPGDPLV 12 +IA ++SCSPGDPLV Sbjct: 48 VIAFISNSCSPGDPLV 63 >SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 26.2 bits (55), Expect = 8.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 Query: 56 IAPRADSCSPGDPLV 12 I ++SCSPGDPLV Sbjct: 18 ICAASNSCSPGDPLV 32 >SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 26.2 bits (55), Expect = 8.1 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -1 Query: 62 VLIAPRADSCSPGDPLV 12 VL ++SCSPGDPLV Sbjct: 14 VLSRVSSNSCSPGDPLV 30 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 90 ELVDPPGCRN 99 >SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 +++SCSPGDPLV Sbjct: 28 KSNSCSPGDPLV 39 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 101 ELVDPPGCRN 110 >SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 14 ELVDPPGCRN 23 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +2 Query: 11 KLVDPPGCRN 40 +LVDPPGCRN Sbjct: 101 ELVDPPGCRN 110 >SB_3006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 26.2 bits (55), Expect = 8.1 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 59 LIAPRADSCSPGDPLV 12 +I ++SCSPGDPLV Sbjct: 10 IIPKPSNSCSPGDPLV 25 >SB_897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 26.2 bits (55), Expect = 8.1 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -1 Query: 68 RRVLIAPRADSCSPGDPLV 12 RR+ I+ ++SCSPGDPLV Sbjct: 36 RRLQIST-SNSCSPGDPLV 53 >SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 26.2 bits (55), Expect = 8.1 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -1 Query: 65 RVLIAPRADSCSPGDPLV 12 R ++ P ++SCSPGDPLV Sbjct: 66 RYVMTP-SNSCSPGDPLV 82 >SB_175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 26.2 bits (55), Expect = 8.1 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -1 Query: 59 LIAPRADSCSPGDPLV 12 +I ++SCSPGDPLV Sbjct: 13 IIVYTSNSCSPGDPLV 28 >SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 26.2 bits (55), Expect = 8.1 Identities = 9/12 (75%), Positives = 12/12 (100%) Frame = -1 Query: 47 RADSCSPGDPLV 12 +++SCSPGDPLV Sbjct: 6 KSNSCSPGDPLV 17 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,911,382 Number of Sequences: 59808 Number of extensions: 166395 Number of successful extensions: 1978 Number of sequences better than 10.0: 241 Number of HSP's better than 10.0 without gapping: 1948 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1978 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 582596255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -