BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0808 (365 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81147-6|CAB03535.1| 506|Caenorhabditis elegans Hypothetical pr... 27 4.1 Z81097-5|CAB03168.1| 243|Caenorhabditis elegans Hypothetical pr... 27 5.4 Z69635-6|CAA93461.1| 695|Caenorhabditis elegans Hypothetical pr... 26 9.5 >Z81147-6|CAB03535.1| 506|Caenorhabditis elegans Hypothetical protein T09E11.8 protein. Length = 506 Score = 27.1 bits (57), Expect = 4.1 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +2 Query: 179 WMLLNWKC-RTESSDFFYCHIVWRAVGPVS 265 W + W C T SD+FYC + R G VS Sbjct: 74 WKPIRWFCLNTTCSDYFYCSMATR-FGSVS 102 >Z81097-5|CAB03168.1| 243|Caenorhabditis elegans Hypothetical protein K07A1.7 protein. Length = 243 Score = 26.6 bits (56), Expect = 5.4 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +1 Query: 190 KLEMSYGIERFFLLSYCLACCWPGLGAKN 276 K E+S RF+L C C W KN Sbjct: 136 KTEISLDGRRFYLQQLCARCLWSDWSCKN 164 >Z69635-6|CAA93461.1| 695|Caenorhabditis elegans Hypothetical protein F19B6.4 protein. Length = 695 Score = 25.8 bits (54), Expect = 9.5 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 225 KKSLDSVRHFQFKSIQQLRILF 160 KKSL S + F F S+Q + +LF Sbjct: 457 KKSLPSFKGFAFVSVQMMHMLF 478 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,415,979 Number of Sequences: 27780 Number of extensions: 126618 Number of successful extensions: 360 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 355 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 360 length of database: 12,740,198 effective HSP length: 73 effective length of database: 10,712,258 effective search space used: 514188384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -