BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0807 (571 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.054 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.50 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.88 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.88 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.88 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 30 1.2 SB_58400| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) 29 2.0 SB_13941| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 28 4.7 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_33340| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_2526| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.7 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 28 6.2 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 28 6.2 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_34430| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 27 8.2 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 27 8.2 SB_43046| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_31130| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 27 8.2 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_795| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 >SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 34.7 bits (76), Expect = 0.054 Identities = 15/24 (62%), Positives = 15/24 (62%) Frame = -2 Query: 72 LGKGYPAPKYLCLVPNSCSPGDPL 1 LGK Y YL NSCSPGDPL Sbjct: 50 LGKSYTEDDYLDWTSNSCSPGDPL 73 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 31.5 bits (68), Expect = 0.50 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -2 Query: 39 CLVPNSCSPGDPL 1 CL+ NSCSPGDPL Sbjct: 69 CLISNSCSPGDPL 81 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 30.7 bits (66), Expect = 0.88 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -2 Query: 42 LCLVPNSCSPGDPL 1 +C V NSCSPGDPL Sbjct: 31 ICTVSNSCSPGDPL 44 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 30.7 bits (66), Expect = 0.88 Identities = 13/19 (68%), Positives = 16/19 (84%), Gaps = 1/19 (5%) Frame = -2 Query: 54 APKY-LCLVPNSCSPGDPL 1 AP++ L L+ NSCSPGDPL Sbjct: 14 APRFPLFLISNSCSPGDPL 32 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 30.7 bits (66), Expect = 0.88 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 45 YLCLVPNSCSPGDPL 1 + C V NSCSPGDPL Sbjct: 23 FYCYVSNSCSPGDPL 37 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/18 (72%), Positives = 15/18 (83%), Gaps = 1/18 (5%) Frame = -2 Query: 51 PKYL-CLVPNSCSPGDPL 1 P+YL +V NSCSPGDPL Sbjct: 341 PQYLHSIVSNSCSPGDPL 358 >SB_58400| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -3 Query: 62 VIQHLNIFASCRIPAARGIH 3 + H+ F S RIPAARGIH Sbjct: 22 IFDHVRSFGSYRIPAARGIH 41 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 30.3 bits (65), Expect = 1.2 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 51 PKYLCLVPNSCSPGDPL 1 P ++ L NSCSPGDPL Sbjct: 6 PYFIMLASNSCSPGDPL 22 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 29.9 bits (64), Expect = 1.5 Identities = 15/25 (60%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = -2 Query: 72 LGKGYPAPKYLCL-VPNSCSPGDPL 1 LG YP Y V NSCSPGDPL Sbjct: 16 LGLLYPTEDYKVYPVSNSCSPGDPL 40 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 29.9 bits (64), Expect = 1.5 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -2 Query: 60 YPAPKYLCLVPNSCSPGDPL 1 + PK + V NSCSPGDPL Sbjct: 14 FSEPKRVNAVSNSCSPGDPL 33 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 29.9 bits (64), Expect = 1.5 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = +3 Query: 3 VDPPGCRNSARGKD 44 VDPPGCRNS GK+ Sbjct: 92 VDPPGCRNSIAGKN 105 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.5 bits (63), Expect = 2.0 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 42 LCLVPNSCSPGDPL 1 +C NSCSPGDPL Sbjct: 13 ICFTSNSCSPGDPL 26 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 29.5 bits (63), Expect = 2.0 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 45 YLCLVPNSCSPGDPL 1 +L L+ NSCSPGDPL Sbjct: 34 FLDLISNSCSPGDPL 48 >SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 29.5 bits (63), Expect = 2.0 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -2 Query: 45 YLCLVPNSCSPGDPL 1 + C + NSCSPGDPL Sbjct: 7 FTCALSNSCSPGDPL 21 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 29.5 bits (63), Expect = 2.0 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 45 YLCLVPNSCSPGDPL 1 Y+ L+ NSCSPGDPL Sbjct: 51 YIPLLSNSCSPGDPL 65 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.5 bits (63), Expect = 2.0 Identities = 12/16 (75%), Positives = 14/16 (87%), Gaps = 1/16 (6%) Frame = -2 Query: 45 YLC-LVPNSCSPGDPL 1 ++C LV NSCSPGDPL Sbjct: 1 FMCMLVSNSCSPGDPL 16 >SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) Length = 736 Score = 29.5 bits (63), Expect = 2.0 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -2 Query: 75 NLGKGYPAPKYLCLVPNSCSPGDPL 1 N G P P + + NSCSPGDPL Sbjct: 598 NRGSLPPPPPPVHFLSNSCSPGDPL 622 >SB_13941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 29.5 bits (63), Expect = 2.0 Identities = 13/23 (56%), Positives = 15/23 (65%), Gaps = 2/23 (8%) Frame = -2 Query: 63 GYPAPKYLCLVP--NSCSPGDPL 1 G P+P +C NSCSPGDPL Sbjct: 15 GIPSPLVVCKFDGSNSCSPGDPL 37 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.5 bits (63), Expect = 2.0 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -2 Query: 60 YPAPKYLCLVPNSCSPGDPL 1 YP + L NSCSPGDPL Sbjct: 3 YPFSTEVYLASNSCSPGDPL 22 >SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 29.5 bits (63), Expect = 2.0 Identities = 13/18 (72%), Positives = 15/18 (83%), Gaps = 1/18 (5%) Frame = -2 Query: 51 PKYLCLVP-NSCSPGDPL 1 PK+ L+P NSCSPGDPL Sbjct: 16 PKHHFLLPSNSCSPGDPL 33 >SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 29.1 bits (62), Expect = 2.7 Identities = 13/19 (68%), Positives = 14/19 (73%), Gaps = 1/19 (5%) Frame = -2 Query: 54 APKYLCLVP-NSCSPGDPL 1 +P C VP NSCSPGDPL Sbjct: 48 SPDAHCRVPSNSCSPGDPL 66 >SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -2 Query: 39 CLVPNSCSPGDPL 1 CL NSCSPGDPL Sbjct: 13 CLRSNSCSPGDPL 25 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.1 bits (62), Expect = 2.7 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 48 KYLCLVPNSCSPGDPL 1 K++ V NSCSPGDPL Sbjct: 12 KFVSKVSNSCSPGDPL 27 >SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.1 bits (62), Expect = 2.7 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 42 LCLVPNSCSPGDPL 1 +C NSCSPGDPL Sbjct: 18 ICAASNSCSPGDPL 31 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 28.7 bits (61), Expect = 3.5 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 54 APKYLCLVPNSCSPGDPL 1 AP L+ NSCSPGDPL Sbjct: 56 APVSRTLLSNSCSPGDPL 73 >SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 28.7 bits (61), Expect = 3.5 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -2 Query: 54 APKYLCLVPNSCSPGDPL 1 +PK+ + NSCSPGDPL Sbjct: 5 SPKHKKSLSNSCSPGDPL 22 >SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.7 bits (61), Expect = 3.5 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -2 Query: 39 CLVPNSCSPGDPL 1 C+ NSCSPGDPL Sbjct: 18 CMKSNSCSPGDPL 30 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 28.7 bits (61), Expect = 3.5 Identities = 13/18 (72%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Frame = -2 Query: 51 PKYLC-LVPNSCSPGDPL 1 P YL +V NSCSPGDPL Sbjct: 5 PFYLIPMVSNSCSPGDPL 22 >SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 28.7 bits (61), Expect = 3.5 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -2 Query: 39 CLVPNSCSPGDPL 1 C NSCSPGDPL Sbjct: 9 CFASNSCSPGDPL 21 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -2 Query: 36 LVPNSCSPGDPL 1 LV NSCSPGDPL Sbjct: 24 LVSNSCSPGDPL 35 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 4.7 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -2 Query: 42 LCLVPNSCSPGDPL 1 + L+ NSCSPGDPL Sbjct: 31 ISLISNSCSPGDPL 44 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -2 Query: 36 LVPNSCSPGDPL 1 LV NSCSPGDPL Sbjct: 3 LVSNSCSPGDPL 14 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -2 Query: 36 LVPNSCSPGDPL 1 LV NSCSPGDPL Sbjct: 17 LVSNSCSPGDPL 28 >SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) Length = 174 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -2 Query: 81 LINLGKGYPAPKYLCLVPNSCSPGDPL 1 ++ + K P +++ L NSCSPGDPL Sbjct: 35 IVEMEKSRPNEEWIFL-SNSCSPGDPL 60 >SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.3 bits (60), Expect = 4.7 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -2 Query: 39 CLVPNSCSPGDPL 1 C + NSCSPGDPL Sbjct: 5 CKLSNSCSPGDPL 17 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -2 Query: 36 LVPNSCSPGDPL 1 LV NSCSPGDPL Sbjct: 9 LVSNSCSPGDPL 20 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 4.7 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -2 Query: 42 LCLVPNSCSPGDPL 1 + L+ NSCSPGDPL Sbjct: 31 ISLISNSCSPGDPL 44 >SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -2 Query: 54 APKYLCLVPNSCSPGDPL 1 A K++ NSCSPGDPL Sbjct: 21 AEKHVKFTSNSCSPGDPL 38 >SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 4.7 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -2 Query: 39 CLVPNSCSPGDPL 1 C + NSCSPGDPL Sbjct: 2 CDISNSCSPGDPL 14 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 4.7 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -2 Query: 42 LCLVPNSCSPGDPL 1 + L+ NSCSPGDPL Sbjct: 31 ISLISNSCSPGDPL 44 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 4.7 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -2 Query: 42 LCLVPNSCSPGDPL 1 + L+ NSCSPGDPL Sbjct: 31 ISLISNSCSPGDPL 44 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 4.7 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -2 Query: 42 LCLVPNSCSPGDPL 1 + L+ NSCSPGDPL Sbjct: 31 ISLISNSCSPGDPL 44 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -2 Query: 36 LVPNSCSPGDPL 1 LV NSCSPGDPL Sbjct: 2 LVSNSCSPGDPL 13 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -2 Query: 42 LCLVPNSCSPGDPL 1 L +V NSCSPGDPL Sbjct: 17 LTVVSNSCSPGDPL 30 >SB_33340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.3 bits (60), Expect = 4.7 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -2 Query: 39 CLVPNSCSPGDPL 1 C + NSCSPGDPL Sbjct: 6 CSLSNSCSPGDPL 18 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -2 Query: 72 LGKGYPAPKYLCLVPNSCSPGDPL 1 +GK + L+ NSCSPGDPL Sbjct: 28 IGKSENLWTFKHLISNSCSPGDPL 51 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 4.7 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -2 Query: 42 LCLVPNSCSPGDPL 1 + L+ NSCSPGDPL Sbjct: 31 ISLISNSCSPGDPL 44 >SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.3 bits (60), Expect = 4.7 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -2 Query: 39 CLVPNSCSPGDPL 1 C + NSCSPGDPL Sbjct: 12 CDISNSCSPGDPL 24 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -2 Query: 36 LVPNSCSPGDPL 1 LV NSCSPGDPL Sbjct: 26 LVSNSCSPGDPL 37 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 4.7 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -2 Query: 42 LCLVPNSCSPGDPL 1 + L+ NSCSPGDPL Sbjct: 32 ISLISNSCSPGDPL 45 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.3 bits (60), Expect = 4.7 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -2 Query: 36 LVPNSCSPGDPL 1 LV NSCSPGDPL Sbjct: 26 LVSNSCSPGDPL 37 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.3 bits (60), Expect = 4.7 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -2 Query: 42 LCLVPNSCSPGDPL 1 + L+ NSCSPGDPL Sbjct: 31 ISLISNSCSPGDPL 44 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 28.3 bits (60), Expect = 4.7 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -2 Query: 42 LCLVPNSCSPGDPL 1 + L+ NSCSPGDPL Sbjct: 29 ISLISNSCSPGDPL 42 >SB_2526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 28.3 bits (60), Expect = 4.7 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 42 LCLVPNSCSPGDPL 1 +C NSCSPGDPL Sbjct: 42 ICHTSNSCSPGDPL 55 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.9 bits (59), Expect = 6.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 36 LVPNSCSPGDPL 1 L+ NSCSPGDPL Sbjct: 17 LISNSCSPGDPL 28 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 27.9 bits (59), Expect = 6.2 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 48 KYLCLVPNSCSPGDPL 1 KY NSCSPGDPL Sbjct: 14 KYKSSTSNSCSPGDPL 29 >SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 27.9 bits (59), Expect = 6.2 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -2 Query: 99 ISK*IFLINLGKGYPAPKYLCL--VPNSCSPGDPL 1 IS I L+ L P C+ NSCSPGDPL Sbjct: 9 ISANIHLVELVALAVVPNIWCMRKTSNSCSPGDPL 43 >SB_18249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 27.9 bits (59), Expect = 6.2 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -1 Query: 37 PRAEFLQPGGST 2 PR EFLQPGGST Sbjct: 40 PRIEFLQPGGST 51 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 27.9 bits (59), Expect = 6.2 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 48 KYLCLVPNSCSPGDPL 1 K + L NSCSPGDPL Sbjct: 74 KGILLTSNSCSPGDPL 89 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.9 bits (59), Expect = 6.2 Identities = 15/23 (65%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = +3 Query: 3 VDPPGCRNSAR-GKDI*VLDNPS 68 VDPPGCRNS + KD V D PS Sbjct: 16 VDPPGCRNSIKVHKD--VKDKPS 36 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.9 bits (59), Expect = 6.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 36 LVPNSCSPGDPL 1 L+ NSCSPGDPL Sbjct: 8 LISNSCSPGDPL 19 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.9 bits (59), Expect = 6.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 45 YLCLVPNSCSPGDPL 1 Y L NSCSPGDPL Sbjct: 3 YNTLASNSCSPGDPL 17 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 6.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 36 LVPNSCSPGDPL 1 L+ NSCSPGDPL Sbjct: 33 LISNSCSPGDPL 44 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 27.9 bits (59), Expect = 6.2 Identities = 9/15 (60%), Positives = 12/15 (80%) Frame = +3 Query: 3 VDPPGCRNSARGKDI 47 VDPPGCRNS + + + Sbjct: 16 VDPPGCRNSIQARSV 30 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 27.9 bits (59), Expect = 6.2 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +3 Query: 3 VDPPGCRNSARGKDI 47 VDPPGCRNS G + Sbjct: 33 VDPPGCRNSIDGNGV 47 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 27.9 bits (59), Expect = 6.2 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +3 Query: 3 VDPPGCRNSARGK 41 VDPPGCRNS + K Sbjct: 16 VDPPGCRNSIKDK 28 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.9 bits (59), Expect = 6.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 36 LVPNSCSPGDPL 1 L+ NSCSPGDPL Sbjct: 24 LISNSCSPGDPL 35 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 27.9 bits (59), Expect = 6.2 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = +3 Query: 3 VDPPGCRNSARG 38 VDPPGCRNS G Sbjct: 16 VDPPGCRNSIEG 27 >SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 27.9 bits (59), Expect = 6.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -2 Query: 39 CLVPNSCSPGDPL 1 C NSCSPGDPL Sbjct: 25 CFSSNSCSPGDPL 37 >SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.9 bits (59), Expect = 6.2 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 Query: 54 APKYLCLVPNSCSPGDPL 1 A Y + NSCSPGDPL Sbjct: 4 AAYYKVITSNSCSPGDPL 21 >SB_34430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 27.9 bits (59), Expect = 6.2 Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -2 Query: 87 IFLINLGKGYPAPKYLCLV-PNSCSPGDPL 1 ++L+NL + PK + NSCSPGDPL Sbjct: 3 LYLLNLIENISFPKSADVNGSNSCSPGDPL 32 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 27.9 bits (59), Expect = 6.2 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 42 LCLVPNSCSPGDPL 1 L L NSCSPGDPL Sbjct: 86 LLLTSNSCSPGDPL 99 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.9 bits (59), Expect = 6.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 36 LVPNSCSPGDPL 1 L+ NSCSPGDPL Sbjct: 16 LISNSCSPGDPL 27 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -2 Query: 48 KYLCLVPNSCSPGDPL 1 +++ V NSCSPGDPL Sbjct: 35 EFVLRVSNSCSPGDPL 50 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +3 Query: 3 VDPPGCRNSAR 35 VDPPGCRNS R Sbjct: 16 VDPPGCRNSIR 26 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 36 LVPNSCSPGDPL 1 +V NSCSPGDPL Sbjct: 77 IVSNSCSPGDPL 88 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -2 Query: 42 LCLVPNSCSPGDPL 1 + +V NSCSPGDPL Sbjct: 5 IVVVSNSCSPGDPL 18 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -2 Query: 42 LCLVPNSCSPGDPL 1 + V NSCSPGDPL Sbjct: 16 IAFVSNSCSPGDPL 29 >SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -2 Query: 45 YLCLVPNSCSPGDPL 1 Y + NSCSPGDPL Sbjct: 31 YRSITSNSCSPGDPL 45 >SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) Length = 210 Score = 27.5 bits (58), Expect = 8.2 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 51 PKYLCLVPNSCSPGDPL 1 PK L NSCSPGDPL Sbjct: 80 PKSEPLSSNSCSPGDPL 96 >SB_43046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -2 Query: 39 CLVPNSCSPGDPL 1 C NSCSPGDPL Sbjct: 2 CEASNSCSPGDPL 14 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 36 LVPNSCSPGDPL 1 +V NSCSPGDPL Sbjct: 1 MVSNSCSPGDPL 12 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 8.2 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -2 Query: 42 LCLVPNSCSPGDPL 1 + ++ NSCSPGDPL Sbjct: 3 IVIISNSCSPGDPL 16 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = +3 Query: 3 VDPPGCRNSAR 35 VDPPGCRNS R Sbjct: 16 VDPPGCRNSIR 26 >SB_31130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -2 Query: 39 CLVPNSCSPGDPL 1 C NSCSPGDPL Sbjct: 6 CEASNSCSPGDPL 18 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 36 LVPNSCSPGDPL 1 +V NSCSPGDPL Sbjct: 85 IVSNSCSPGDPL 96 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 36 LVPNSCSPGDPL 1 +V NSCSPGDPL Sbjct: 13 IVSNSCSPGDPL 24 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 36 LVPNSCSPGDPL 1 +V NSCSPGDPL Sbjct: 6 IVSNSCSPGDPL 17 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 27.5 bits (58), Expect = 8.2 Identities = 13/15 (86%), Positives = 13/15 (86%), Gaps = 1/15 (6%) Frame = -2 Query: 42 LCLVP-NSCSPGDPL 1 L LVP NSCSPGDPL Sbjct: 25 LPLVPSNSCSPGDPL 39 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -2 Query: 36 LVPNSCSPGDPL 1 +V NSCSPGDPL Sbjct: 1 MVSNSCSPGDPL 12 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = +3 Query: 3 VDPPGCRNSARG 38 VDPPGCRNS G Sbjct: 103 VDPPGCRNSITG 114 >SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.5 bits (58), Expect = 8.2 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -2 Query: 51 PKYLCLVPNSCSPGDPL 1 PK + NSCSPGDPL Sbjct: 29 PKQESIRSNSCSPGDPL 45 >SB_795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -2 Query: 45 YLCLVPNSCSPGDPL 1 Y+ NSCSPGDPL Sbjct: 4 YIFYASNSCSPGDPL 18 >SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 48 KYLCLVPNSCSPGDPL 1 +Y+ NSCSPGDPL Sbjct: 66 RYVMTPSNSCSPGDPL 81 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,018,146 Number of Sequences: 59808 Number of extensions: 255046 Number of successful extensions: 1934 Number of sequences better than 10.0: 94 Number of HSP's better than 10.0 without gapping: 1892 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1934 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1349364063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -