BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0806 (498 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g56470.1 68416.m06280 F-box family protein similar to F-box p... 27 9.3 At1g11800.1 68414.m01354 endonuclease/exonuclease/phosphatase fa... 27 9.3 At1g03010.1 68414.m00273 phototropic-responsive NPH3 family prot... 27 9.3 >At3g56470.1 68416.m06280 F-box family protein similar to F-box protein family, AtFBX7 (GI:20197899) [Arabidopsis thaliana] Length = 367 Score = 26.6 bits (56), Expect = 9.3 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -3 Query: 334 CV*SPPLPAAWVQRMALSCSRLHGNTSCL 248 CV P L A+ QRMA SC+ +TSCL Sbjct: 136 CVPMPTLWMAYDQRMAFSCAPT--STSCL 162 >At1g11800.1 68414.m01354 endonuclease/exonuclease/phosphatase family protein contains Pfam profile PF03372: Endonuclease/Exonuclease/phosphatase family Length = 441 Score = 26.6 bits (56), Expect = 9.3 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = -2 Query: 347 TVREVRLVT--AATGSMGPADGALLLSPSRKHFLFICVEPGSTPRCPSGTPSMS 192 T+R +R+VT A + S L S S+K IC+ P S P PS+S Sbjct: 4 TIRFLRIVTSRAMSSSWSCNKCTFLNSASQKLNCMICLAPVSLPSLSPPPPSLS 57 >At1g03010.1 68414.m00273 phototropic-responsive NPH3 family protein contains NPH3 family domain, Pfam:PF03000 Length = 634 Score = 26.6 bits (56), Expect = 9.3 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +3 Query: 336 LAHCSTYLPIISYLKFGAPLLLSTANNSVAE 428 L HC T +P+ L L+++ ANN+ E Sbjct: 150 LHHCETLIPVSEDLNLVNRLIIAVANNACKE 180 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,844,846 Number of Sequences: 28952 Number of extensions: 186139 Number of successful extensions: 512 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 499 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 510 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 878448512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -