BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0805 (517 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0319 - 8917042-8917122,8917628-8917680,8917754-8917800,891... 31 0.55 02_03_0149 - 15744153-15744157,15744254-15744380,15744600-157447... 28 3.9 09_06_0131 - 21037698-21038210,21038293-21038532,21038679-210387... 28 5.1 08_02_1505 - 27581466-27581978,27582054-27582293,27582527-275826... 28 5.1 08_02_1328 + 26170248-26170493,26170702-26170798,26171325-261713... 28 5.1 05_01_0253 + 1934043-1934201,1934456-1934536,1935008-1935199,193... 27 8.9 >02_02_0319 - 8917042-8917122,8917628-8917680,8917754-8917800, 8917901-8917992,8919725-8920060,8920370-8920423, 8920547-8920879,8921133-8921207,8921293-8921441, 8922411-8922429 Length = 412 Score = 31.1 bits (67), Expect = 0.55 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +3 Query: 93 LKSVHRNSEMLSVYTWCFTIHKGTHN*GIRMLSVLTRHG 209 L S+H N +S Y CF +H+ RM+ +L RHG Sbjct: 151 LGSMHANPNCMSPYG-CFPLHEAAERCSPRMIRLLFRHG 188 >02_03_0149 - 15744153-15744157,15744254-15744380,15744600-15744713, 15744949-15745014,15745106-15745208,15746263-15746318, 15746531-15746756,15746872-15747008 Length = 277 Score = 28.3 bits (60), Expect = 3.9 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 13 GIRHEAFIYKHYSTNVKRLVFGRVALCLRVYIE 111 GI + A +Y H LVFG C+ +YI+ Sbjct: 142 GIFNPAIVYDHLGEIYSALVFGSFVFCIFLYIK 174 >09_06_0131 - 21037698-21038210,21038293-21038532,21038679-21038789, 21038872-21038926,21039074-21039210,21039284-21039421, 21040304-21040494,21040625-21040703 Length = 487 Score = 27.9 bits (59), Expect = 5.1 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +1 Query: 46 YSTNVKRLVFG-RVALCLRVYIEIVRCYRY 132 YSTN ++ F R+A CL ++ E V+ R+ Sbjct: 422 YSTNEPQIAFNSRIAFCLNMHNEAVKALRF 451 >08_02_1505 - 27581466-27581978,27582054-27582293,27582527-27582637, 27582732-27582786,27582880-27583016,27583092-27583229, 27583293-27583355,27584379-27584569,27584657-27584732 Length = 507 Score = 27.9 bits (59), Expect = 5.1 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +1 Query: 46 YSTNVKRLVFG-RVALCLRVYIEIVRCYRY 132 YSTN ++ F R+A CL ++ E V+ R+ Sbjct: 442 YSTNEPQIAFNSRIAFCLNMHNEAVKAMRF 471 >08_02_1328 + 26170248-26170493,26170702-26170798,26171325-26171342, 26171566-26171666,26173486-26173562,26173736-26173802, 26176467-26176577,26176652-26176749,26176834-26176903 Length = 294 Score = 27.9 bits (59), Expect = 5.1 Identities = 11/25 (44%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = +3 Query: 240 SFLAGLPEPL-FLFTYLIKIPLLFY 311 ++L LPEP F+FT+ +PL+F+ Sbjct: 198 TYLLELPEPFSFIFTWFAALPLIFW 222 >05_01_0253 + 1934043-1934201,1934456-1934536,1935008-1935199, 1935313-1935548,1935638-1936220 Length = 416 Score = 27.1 bits (57), Expect = 8.9 Identities = 12/50 (24%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +3 Query: 237 ASFLAGLPEPLFLFTYLIKIPLLFYYGL-CTYIIYLHMYTIQHLKYF*KF 383 A+ A P P+ +++P + YYG+ C + Y +++++ K +F Sbjct: 31 AAAAAVAPPPVVEVEVAVQVPHMVYYGVYCLSVYYTRLFSVRGCKRLTQF 80 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,319,537 Number of Sequences: 37544 Number of extensions: 227247 Number of successful extensions: 369 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 369 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 369 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1118831240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -