BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0805 (517 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CY... 24 2.6 AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CY... 24 3.5 DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. 23 6.1 >AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CYPm3r5 protein. Length = 519 Score = 24.2 bits (50), Expect = 2.6 Identities = 11/28 (39%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = +1 Query: 88 LCLRVYIEIVRCYRYTRGV-LPYTKEHI 168 LCL VY+ +VR Y + R +PY + + Sbjct: 18 LCLCVYLLVVRKYSFWRSYHVPYVEPEL 45 >AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CYP12F2 protein. Length = 522 Score = 23.8 bits (49), Expect = 3.5 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = +3 Query: 183 MLSVLTRHGVLTINKITTASFLAGLPEPLFLFTYLIKIPLLFYYGLCT 326 +L++ TR GVL + A + GL +F TY + + + + + T Sbjct: 216 VLALDTRFGVLKDEQTEEAKKILGLVRNIFELTYKLDVEMSLWKYIST 263 >DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. Length = 418 Score = 23.0 bits (47), Expect = 6.1 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +2 Query: 224 QNYHSVIPCRIARTTVSV 277 Q YHS+I R TT SV Sbjct: 138 QKYHSIIAARYNATTQSV 155 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 530,035 Number of Sequences: 2352 Number of extensions: 10687 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46937349 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -