BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0805 (517 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g52180.1 68418.m06477 expressed protein 28 4.3 At1g75990.1 68414.m08824 26S proteasome regulatory subunit S3, p... 28 4.3 At1g20200.1 68414.m02524 26S proteasome regulatory subunit S3, p... 28 4.3 At1g50430.1 68414.m05652 7-dehydrocholesterol reductase / 7-DHC ... 27 5.7 >At5g52180.1 68418.m06477 expressed protein Length = 458 Score = 27.9 bits (59), Expect = 4.3 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 267 LFLFTYLIKIPLLFYYGLCTYI 332 L L +KI ++F +GLCTYI Sbjct: 21 LTLVLSFVKISIIFLHGLCTYI 42 >At1g75990.1 68414.m08824 26S proteasome regulatory subunit S3, putative (RPN3) similar to 26S proteasome regulatory subunit S3 SP:P93768 [Nicotiana tabacum (Common tobacco)] Length = 487 Score = 27.9 bits (59), Expect = 4.3 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +1 Query: 46 YSTNVKRLVFG-RVALCLRVYIEIVRCYRY 132 YSTN + F R+A CL ++ E VR R+ Sbjct: 422 YSTNEPQTAFNSRIAFCLNMHNEAVRALRF 451 >At1g20200.1 68414.m02524 26S proteasome regulatory subunit S3, putative (RPN3) similar to SP:Q06364 from [Daucus carota] Length = 488 Score = 27.9 bits (59), Expect = 4.3 Identities = 13/30 (43%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +1 Query: 46 YSTNVKRLVFG-RVALCLRVYIEIVRCYRY 132 YSTN + F R+A CL ++ E VR R+ Sbjct: 423 YSTNEPQTAFNSRIAFCLNMHNEAVRALRF 452 >At1g50430.1 68414.m05652 7-dehydrocholesterol reductase / 7-DHC reductase / sterol delta-7-reductase (ST7R) / dwarf5 protein (DWF5) identical to SP|Q9LDU6 7-dehydrocholesterol reductase (EC 1.3.1.21) (7-DHC reductase) (Sterol delta-7-reductase) (Dwarf5 protein) {Arabidopsis thaliana} Length = 432 Score = 27.5 bits (58), Expect = 5.7 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 13 GIRHEAFIYKHYSTNVKRLVFGRVALCLRVYIE 111 GI + A +Y H L+FG C+ +YI+ Sbjct: 124 GIFNPAIVYDHLGEIFSALIFGSFIFCVLLYIK 156 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,406,360 Number of Sequences: 28952 Number of extensions: 199523 Number of successful extensions: 327 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 323 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 327 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -