BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0804 (498 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ850297-1|CAH64517.1| 539|Tribolium castaneum putative esteras... 22 2.7 AJ850295-1|CAH64515.1| 539|Tribolium castaneum putative esteras... 22 2.7 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 21 8.1 >AJ850297-1|CAH64517.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 22.2 bits (45), Expect = 2.7 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +3 Query: 138 DTKWLMPNGNPTGIYVYNCIANQRVPIILND 230 D W++ N G+Y N I + + +L+D Sbjct: 312 DVPWIVSFTNSEGLYAINEIYDNALLALLDD 342 >AJ850295-1|CAH64515.1| 539|Tribolium castaneum putative esterase protein. Length = 539 Score = 22.2 bits (45), Expect = 2.7 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +3 Query: 138 DTKWLMPNGNPTGIYVYNCIANQRVPIILND 230 D W++ N G+Y N I + + +L+D Sbjct: 312 DVPWIVSFTNSEGLYAINEIYDNALLALLDD 342 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 20.6 bits (41), Expect = 8.1 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 206 LVRNTIINVNTCRVSIRH 153 L+RN I N+NT + H Sbjct: 186 LIRNKISNLNTSLIHSTH 203 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,819 Number of Sequences: 336 Number of extensions: 2712 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11735024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -