BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0804 (498 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 23 4.4 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 23 4.4 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 23 4.4 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 23 4.4 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 23 4.4 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 23 4.4 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 23 4.4 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 23 4.4 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 23 4.4 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 23 4.4 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 23 4.4 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 23 4.4 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 23 4.4 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 23 4.4 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 23 4.4 AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 pr... 23 4.4 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 23 4.4 AF185643-1|AAF15578.1| 117|Anopheles gambiae Toll-related prote... 23 4.4 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 23 5.8 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 5.8 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 7.6 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 4.4 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 153 MPNGNPTGIYVYNCIANQRVPIILNDPHI 239 M +G P G + A R P++L D H+ Sbjct: 25 MSHGAPVGTKTASETAGPRGPVLLQDVHL 53 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 4.4 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 153 MPNGNPTGIYVYNCIANQRVPIILNDPHI 239 M +G P G + A R P++L D H+ Sbjct: 25 MSHGAPVGTKTASETAGPRGPVLLQDVHL 53 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 4.4 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 153 MPNGNPTGIYVYNCIANQRVPIILNDPHI 239 M +G P G + A R P++L D H+ Sbjct: 25 MSHGAPVGTKTASETAGPRGPVLLQDVHL 53 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 4.4 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 153 MPNGNPTGIYVYNCIANQRVPIILNDPHI 239 M +G P G + A R P++L D H+ Sbjct: 25 MSHGAPVGTKTASETAGPRGPVLLQDVHL 53 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 4.4 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 153 MPNGNPTGIYVYNCIANQRVPIILNDPHI 239 M +G P G + A R P++L D H+ Sbjct: 25 MSHGAPVGTKTASETAGPRGPVLLQDVHL 53 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 4.4 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 153 MPNGNPTGIYVYNCIANQRVPIILNDPHI 239 M +G P G + A R P++L D H+ Sbjct: 25 MSHGAPVGTKTASETAGPRGPVLLQDVHL 53 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 4.4 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 153 MPNGNPTGIYVYNCIANQRVPIILNDPHI 239 M +G P G + A R P++L D H+ Sbjct: 25 MSHGAPVGTKTASETAGPRGPVLLQDVHL 53 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 4.4 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 153 MPNGNPTGIYVYNCIANQRVPIILNDPHI 239 M +G P G + A R P++L D H+ Sbjct: 25 MSHGAPVGTKTASETAGPRGPVLLQDVHL 53 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 4.4 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 153 MPNGNPTGIYVYNCIANQRVPIILNDPHI 239 M +G P G + A R P++L D H+ Sbjct: 25 MSHGAPVGTKTASETAGPRGPVLLQDVHL 53 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 4.4 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 153 MPNGNPTGIYVYNCIANQRVPIILNDPHI 239 M +G P G + A R P++L D H+ Sbjct: 25 MSHGAPVGTKTASETAGPRGPVLLQDVHL 53 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 4.4 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 153 MPNGNPTGIYVYNCIANQRVPIILNDPHI 239 M +G P G + A R P++L D H+ Sbjct: 25 MSHGAPVGTKTASETAGPRGPVLLQDVHL 53 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 4.4 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 153 MPNGNPTGIYVYNCIANQRVPIILNDPHI 239 M +G P G + A R P++L D H+ Sbjct: 25 MSHGAPVGTKTASETAGPRGPVLLQDVHL 53 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 4.4 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 153 MPNGNPTGIYVYNCIANQRVPIILNDPHI 239 M +G P G + A R P++L D H+ Sbjct: 25 MSHGAPVGTKTASETAGPRGPVLLQDVHL 53 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 23.4 bits (48), Expect = 4.4 Identities = 13/53 (24%), Positives = 27/53 (50%) Frame = +3 Query: 147 WLMPNGNPTGIYVYNCIANQRVPIILNDPHIATWYSCGPTVYESAHIGHASCY 305 +L NP Y+Y I R+ +L ++ T+ S +++++A + +CY Sbjct: 25 YLFTQCNPLSTYLYRTILALRLVTLLPCFNVLTFISSFFSLFQTARV--LTCY 75 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 23.4 bits (48), Expect = 4.4 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 153 MPNGNPTGIYVYNCIANQRVPIILNDPHI 239 M +G P G + A R P++L D H+ Sbjct: 9 MSHGAPVGTKTASETAGPRGPVLLQDVHL 37 >AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 protein. Length = 505 Score = 23.4 bits (48), Expect = 4.4 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -2 Query: 452 ILFSNICEVCFTFEAFLNDFV 390 ++FS ICE+ F A +N FV Sbjct: 147 LMFSTICEIGDEFLATVNRFV 167 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 23.4 bits (48), Expect = 4.4 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = -1 Query: 147 ILYLYKVLSYTREIMSGQKLN*KPSFLLMIHFRQFELADTLVPN 16 I Y K ++ E ++ N PS+ L +H+R F + + N Sbjct: 1088 ISYSSKDEAFVAEELAPMLENEDPSYKLCLHYRDFPVGAYIADN 1131 >AF185643-1|AAF15578.1| 117|Anopheles gambiae Toll-related protein protein. Length = 117 Score = 23.4 bits (48), Expect = 4.4 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = -1 Query: 147 ILYLYKVLSYTREIMSGQKLN*KPSFLLMIHFRQFELADTLVPN 16 I Y K ++ E ++ N PS+ L +H+R F + + N Sbjct: 2 ISYSSKDEAFVAEELAPMLENEDPSYKLCLHYRDFPVGAYIADN 45 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.0 bits (47), Expect = 5.8 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +2 Query: 146 MAYAEWKPYRYLRL 187 +A EWKP+ YL L Sbjct: 107 IAIVEWKPFEYLIL 120 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 5.8 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = -2 Query: 44 SNLLIPSCRIP 12 SNL +PSCR+P Sbjct: 97 SNLELPSCRLP 107 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 22.6 bits (46), Expect = 7.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -1 Query: 108 IMSGQKLN*KPSFLLMIHFR 49 ++ GQKLN K FL+M + R Sbjct: 920 VLDGQKLNLKVFFLIMNYDR 939 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 524,631 Number of Sequences: 2352 Number of extensions: 11318 Number of successful extensions: 42 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44400195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -