BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0804 (498 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 25 0.44 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 5.4 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 25.0 bits (52), Expect = 0.44 Identities = 11/50 (22%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Frame = +3 Query: 81 FNLTFVRS--LSHVCSLKPYKDTKWLMPNGNPTGIYVYNCIANQRVPIIL 224 +N+TF ++ + P K W+ N G VY+ + + +P+++ Sbjct: 213 YNMTFAQNGPFNTTTIFVPVKPCPWICELTNDAGYVVYSALGSFYIPMLV 262 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 5.4 Identities = 6/23 (26%), Positives = 13/23 (56%) Frame = -1 Query: 318 YRVSHSSWRDLCEQIRIPWGHKN 250 Y++S SW +++ +P +N Sbjct: 913 YKISKGSWETDIDRVLVPGSQQN 935 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,343 Number of Sequences: 438 Number of extensions: 2959 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -