BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0803 (325 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein... 23 3.8 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 22 6.6 >AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein coupled receptor protein. Length = 459 Score = 22.6 bits (46), Expect = 3.8 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +2 Query: 134 LRAWTNVEEWEKNKMLWIILTNKFITL*ICLVPIC 238 + W NV + ML +LTN I L V +C Sbjct: 81 IHLWRNVRNTKHALMLKCLLTNDLIGLSGMFVQMC 115 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 21.8 bits (44), Expect = 6.6 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = +2 Query: 14 YTSFEMEWYRNL 49 Y F +EWYR L Sbjct: 303 YYRFRLEWYRTL 314 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 264,852 Number of Sequences: 2352 Number of extensions: 4295 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 56 effective length of database: 432,267 effective search space used: 22045617 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -