BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0797 (509 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_O66434 Cluster: 50S ribosomal protein L2; n=113; cellul... 33 3.8 UniRef50_Q2J7E5 Cluster: Putative uncharacterized protein; n=2; ... 32 8.7 >UniRef50_O66434 Cluster: 50S ribosomal protein L2; n=113; cellular organisms|Rep: 50S ribosomal protein L2 - Aquifex aeolicus Length = 304 Score = 33.1 bits (72), Expect = 3.8 Identities = 19/49 (38%), Positives = 24/49 (48%) Frame = -2 Query: 208 TVSMTTIAQTAMISSGKAAVARAVSWTRPSALDVASGGGDHQHGEGNEG 62 TV +A+ ++ GKA AR + W RP A DH HG G EG Sbjct: 218 TVGRVGLAEHELVKLGKAGRARWLGW-RPHTRGTAMNPVDHPHG-GGEG 264 >UniRef50_Q2J7E5 Cluster: Putative uncharacterized protein; n=2; Frankia|Rep: Putative uncharacterized protein - Frankia sp. (strain CcI3) Length = 156 Score = 31.9 bits (69), Expect = 8.7 Identities = 20/46 (43%), Positives = 25/46 (54%) Frame = -2 Query: 184 QTAMISSGKAAVARAVSWTRPSALDVASGGGDHQHGEGNEGSVESH 47 +TA IS KA ARA W P+ L +GG H GE + G E+H Sbjct: 49 ETADISVDKACAARA--WAPPAHLVSHTGGEGHAGGEAHAGG-EAH 91 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 344,282,338 Number of Sequences: 1657284 Number of extensions: 4665724 Number of successful extensions: 14948 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14525 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14934 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 30946432294 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -