BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0796 (417 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0349 - 3082700-3083407 28 2.6 05_01_0372 - 2913518-2916562,2916674-2917528 28 2.6 08_01_0052 + 361505-361969,362270-362348,362816-362880,363069-36... 27 4.6 07_01_0548 - 4061829-4062956 27 6.0 03_02_0693 - 10441253-10441294,10441404-10441511,10441594-104416... 27 6.0 01_05_0810 - 25435193-25435323,25435434-25436360,25436459-254369... 27 8.0 >08_01_0349 - 3082700-3083407 Length = 235 Score = 28.3 bits (60), Expect = 2.6 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +1 Query: 304 AKLATSVFAIVLFFLGNFGITAGAHRLWSHNGYKVKLP 417 A+L+ FAI++ FL F + + R +SH G V +P Sbjct: 104 AELSVKFFAILVCFLLAFLLNVQSIRYYSHTGLLVNVP 141 >05_01_0372 - 2913518-2916562,2916674-2917528 Length = 1299 Score = 28.3 bits (60), Expect = 2.6 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +2 Query: 305 QNWLHRFLLLCYSS 346 Q+W H+ LLLCYSS Sbjct: 855 QSWRHQMLLLCYSS 868 >08_01_0052 + 361505-361969,362270-362348,362816-362880,363069-363236, 363731-364171 Length = 405 Score = 27.5 bits (58), Expect = 4.6 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -1 Query: 150 FICFIH*IRRHFSNLDFNFIYLL*VI*FYNTKYLLKKFCS 31 F+C + +R H NLD F F + Y L++FCS Sbjct: 159 FVCVVWYLRSHLFNLDLQFF-------FNHVVYRLQQFCS 191 >07_01_0548 - 4061829-4062956 Length = 375 Score = 27.1 bits (57), Expect = 6.0 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +1 Query: 115 KMPPNSVDKTNETEYLKDNHVDYE 186 ++PP DK + +L DNH D+E Sbjct: 180 EVPPAIFDKKIDALFLNDNHFDFE 203 >03_02_0693 - 10441253-10441294,10441404-10441511,10441594-10441677, 10441765-10443062,10443111-10444804,10444890-10444957, 10445057-10445186,10445292-10445415,10445551-10445711, 10446714-10446868 Length = 1287 Score = 27.1 bits (57), Expect = 6.0 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +1 Query: 118 MPPNSVDKTNETEYLKDNHVDYEKLIAPQASPI 216 M PNS D E D+H Y + +PQA P+ Sbjct: 394 MVPNSSDVVPAEEENNDHHQGYVCVPSPQAKPV 426 >01_05_0810 - 25435193-25435323,25435434-25436360,25436459-25436987, 25437089-25437190 Length = 562 Score = 26.6 bits (56), Expect = 8.0 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -1 Query: 246 YHVHHYNFVFDGRGLG 199 +H+H YNF GRG+G Sbjct: 465 FHLHGYNFFVVGRGVG 480 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,575,933 Number of Sequences: 37544 Number of extensions: 163773 Number of successful extensions: 321 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 316 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 321 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 754585524 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -