BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0795 (531 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 3.4 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 22 4.5 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 21 7.9 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 7.9 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 22.2 bits (45), Expect = 3.4 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = +1 Query: 487 PIFMMLWQTWHLKEN 531 P +++ W+ W LK N Sbjct: 259 PTYLIKWKNWDLKYN 273 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 21.8 bits (44), Expect = 4.5 Identities = 13/51 (25%), Positives = 22/51 (43%) Frame = -3 Query: 232 VDLTKRTNKFLYLTDMLELKNAYYITLMFKIYKKFENVIQLIFQNLNLKLV 80 +D RTN+ + M N Y + L K+ K N F +N +++ Sbjct: 522 MDRMDRTNRMDRMNRMNRQMNEYMMALSMKLQKFINN--DYNFNEVNFRIL 570 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.0 bits (42), Expect = 7.9 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = +3 Query: 378 IKHCILFIQRYDYIKAE 428 IKH ++++Q+Y Y+ E Sbjct: 528 IKHDMVYLQKYFYLFME 544 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.0 bits (42), Expect = 7.9 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = +3 Query: 378 IKHCILFIQRYDYIKAE 428 IKH ++++Q+Y Y+ E Sbjct: 528 IKHDMVYLQKYFYLFME 544 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,804 Number of Sequences: 438 Number of extensions: 2908 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14968302 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -