BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0794 (434 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g59440.2 68418.m07450 thymidylate kinase family protein simil... 30 0.59 At5g59440.1 68418.m07449 thymidylate kinase family protein simil... 30 0.59 At1g72040.1 68414.m08327 deoxynucleoside kinase family contains ... 29 1.4 At3g28380.1 68416.m03546 P-glycoprotein, putative similar to P-g... 28 2.4 At2g20810.1 68415.m02448 glycosyl transferase family 8 protein c... 28 2.4 At4g18050.1 68417.m02686 ABC transporter family protein contains... 27 4.1 At5g59380.1 68418.m07441 methyl-CpG-binding domain-containing pr... 27 5.5 At5g46540.1 68418.m05730 ABC transporter family protein contains... 27 7.2 At4g28620.1 68417.m04092 ABC transporter family protein identica... 27 7.2 At3g27440.1 68416.m03430 uracil phosphoribosyltransferase, putat... 27 7.2 At2g18720.1 68415.m02180 eukaryotic translation initiation facto... 27 7.2 At4g32880.1 68417.m04679 homeobox-leucine zipper transcription f... 26 9.5 At3g48675.1 68416.m05315 hypothetical protein 26 9.5 At2g43360.1 68415.m05391 biotin synthase (BioB) (BIO2) identical... 26 9.5 >At5g59440.2 68418.m07450 thymidylate kinase family protein similar to thymidylate kinase GI:291900 Length = 224 Score = 30.3 bits (65), Expect = 0.59 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 2/78 (2%) Frame = +3 Query: 87 LQISNMNTISKTARIVRKRPFRVSIEGNIGSGKST-CIKFFNKFHNVEHHTEPLH-EWRD 260 ++ SN ++ +T V+ R + +EG SGKST C K + + + H TE R+ Sbjct: 1 MESSNFSSGVRTESSVKPRGALIVLEGLDRSGKSTQCAKLLSFLNGLGHPTELWRFPDRE 60 Query: 261 VSGHNLLSLMYSGSEEMD 314 S ++S S ++D Sbjct: 61 TSVGQMISAYLSNKSQLD 78 >At5g59440.1 68418.m07449 thymidylate kinase family protein similar to thymidylate kinase GI:291900 Length = 263 Score = 30.3 bits (65), Expect = 0.59 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 2/78 (2%) Frame = +3 Query: 87 LQISNMNTISKTARIVRKRPFRVSIEGNIGSGKST-CIKFFNKFHNVEHHTEPLH-EWRD 260 ++ SN ++ +T V+ R + +EG SGKST C K + + + H TE R+ Sbjct: 40 MESSNFSSGVRTESSVKPRGALIVLEGLDRSGKSTQCAKLLSFLNGLGHPTELWRFPDRE 99 Query: 261 VSGHNLLSLMYSGSEEMD 314 S ++S S ++D Sbjct: 100 TSVGQMISAYLSNKSQLD 117 >At1g72040.1 68414.m08327 deoxynucleoside kinase family contains Pfam profile: PF01712 deoxynucleoside kinase Length = 580 Score = 29.1 bits (62), Expect = 1.4 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 7/60 (11%) Frame = +3 Query: 138 KRPFRVSIEGNIGSGKSTCI-KFFNKFHN----VEHHTEPLHEWRDVS-GH-NLLSLMYS 296 K+ +EGNI GKST + + N+ VE EP+ +W+DV H N+L YS Sbjct: 263 KKRLTFCVEGNISVGKSTFLQRIANETVELQDLVEIVPEPVDKWQDVGPDHFNILDAFYS 322 >At3g28380.1 68416.m03546 P-glycoprotein, putative similar to P-glycoprotein homologue GI:2292907 from [Hordeum vulgare subsp. vulgare] Length = 1240 Score = 28.3 bits (60), Expect = 2.4 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = +3 Query: 156 SIEGNIGSGKSTCIKFFNKFHNVEHHTEPLHEWRDVSGHNLLSL 287 +I G GSGKST I +F++ T + + RD+ ++L SL Sbjct: 1027 AIVGTSGSGKSTIIGLIERFYDPLKGTVKI-DGRDIRSYHLRSL 1069 >At2g20810.1 68415.m02448 glycosyl transferase family 8 protein contains Pfam profile: PF01501 glycosyl transferase family 8 Length = 536 Score = 28.3 bits (60), Expect = 2.4 Identities = 8/33 (24%), Positives = 19/33 (57%) Frame = +3 Query: 147 FRVSIEGNIGSGKSTCIKFFNKFHNVEHHTEPL 245 F + + N+ TC++ F+++H +++ PL Sbjct: 376 FSIDLNKNVNGAVETCMETFHRYHKYLNYSHPL 408 >At4g18050.1 68417.m02686 ABC transporter family protein contains Pfam profile: PF00005 ABC transporter; similar to multidrug-resistant protein CjMDR1 GI:14715462 from [Coptis japonica] Length = 1281 Score = 27.5 bits (58), Expect = 4.1 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +3 Query: 153 VSIEGNIGSGKSTCIKFFNKFHN 221 V++ G GSGKST I +F+N Sbjct: 1024 VALVGESGSGKSTVISMIERFYN 1046 Score = 26.6 bits (56), Expect = 7.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 153 VSIEGNIGSGKSTCIKFFNKFHNVE 227 V++ G GSGKST I +F++ E Sbjct: 386 VALVGQSGSGKSTVISLIERFYDPE 410 >At5g59380.1 68418.m07441 methyl-CpG-binding domain-containing protein similar to testis specific methyl-CpG binding protein MBD2 [Homo sapiens] GI:3800801; contains Pfam profile PF01429: Methyl-CpG binding domain Length = 225 Score = 27.1 bits (57), Expect = 5.5 Identities = 18/49 (36%), Positives = 22/49 (44%) Frame = +3 Query: 135 RKRPFRVSIEGNIGSGKSTCIKFFNKFHNVEHHTEPLHEWRDVSGHNLL 281 ++RP + I G GSG+S I N V H TE R G N L Sbjct: 34 KRRPIQGGI-GISGSGESVRIGMANGTDQVNHQTESKSRKRAAPGDNWL 81 >At5g46540.1 68418.m05730 ABC transporter family protein contains Pfam profile: PF00005 ABC transporter; similar to multidrug-resistant protein CjMDR1 GI:14715462 from [Coptis japonica] Length = 1248 Score = 26.6 bits (56), Expect = 7.2 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 153 VSIEGNIGSGKSTCIKFFNKFHNVE 227 V++ G GSGKST I +F++ E Sbjct: 388 VALVGQSGSGKSTVISLIERFYDPE 412 >At4g28620.1 68417.m04092 ABC transporter family protein identical to half-molecule ABC transporter ATM2 GI:9964119 from [Arabidopsis thaliana] Length = 680 Score = 26.6 bits (56), Expect = 7.2 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +3 Query: 153 VSIEGNIGSGKSTCIKFFNKFHNVE 227 V+I G+ GSGKST ++ +F +V+ Sbjct: 468 VAIVGSSGSGKSTILRMIFRFFDVD 492 >At3g27440.1 68416.m03430 uracil phosphoribosyltransferase, putative / UMP pyrophosphorylase, putative / UPRTase, putative similar to SP|O65583 Uracil phosphoribosyltransferase (EC 2.4.2.9) (UMP pyrophosphorylase) (UPRTase) {Arabidopsis thaliana}; contains Pfam profile PF00485: Phosphoribulokinase / Uridine kinase family Length = 465 Score = 26.6 bits (56), Expect = 7.2 Identities = 12/38 (31%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +3 Query: 111 ISKTARIVRKRPFRVSIEGNIGSGKST-CIKFFNKFHN 221 +S +A K+PF + + G SGK+T C ++ H+ Sbjct: 18 VSPSAPAPLKQPFVIGVAGGTASGKTTVCNMIMSQLHD 55 >At2g18720.1 68415.m02180 eukaryotic translation initiation factor 2 subunit 3, putative / eIF2S3, putative / eIF-2-gamma, putative Length = 465 Score = 26.6 bits (56), Expect = 7.2 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = +3 Query: 87 LQISNMNTISKTARIVRKRPFRVSIEGNIGSGKSTCIKFFNKFHNVEHHTE 239 L ++ ++ +S I R+ + G++ GKST +K + H V+ +E Sbjct: 15 LDVAQLHPLSPEV-ISRQATINIGTIGHVAHGKSTIVKAVSGVHTVKFKSE 64 >At4g32880.1 68417.m04679 homeobox-leucine zipper transcription factor (HB-8) identical to HD-zip transcription factor (athb-8) (GI:7270235) [Arabidopsis thaliana] Length = 833 Score = 26.2 bits (55), Expect = 9.5 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +3 Query: 162 EGNIGSGKSTCIKFFNKFHNVEHHTEPLHEWRDVSGHNLLSL 287 +GN+ + ++C + +HH P H+ RD S LLS+ Sbjct: 122 QGNLATTDTSCESVVT---SGQHHLTPQHQPRDASPAGLLSI 160 >At3g48675.1 68416.m05315 hypothetical protein Length = 119 Score = 26.2 bits (55), Expect = 9.5 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = -1 Query: 236 SMVFNIMKLVEEFYTC*FSRSYVSFN*HSKRSF-AYDTSC 120 S +FN+ V+E Y FS + S ++F A DT+C Sbjct: 49 SSLFNVQGCVQEIYKSIFSGQFASIEAPCCKTFSAIDTNC 88 >At2g43360.1 68415.m05391 biotin synthase (BioB) (BIO2) identical to SP|P54967 Pfam profile PF04055: radical SAM domain protein Length = 378 Score = 26.2 bits (55), Expect = 9.5 Identities = 15/50 (30%), Positives = 23/50 (46%) Frame = +3 Query: 213 FHNVEHHTEPLHEWRDVSGHNLLSLMYSGSEEMDLYIPXTMYIXSRLKIQ 362 FH + H +H +R+V LLS+ G E Y P + + +K Q Sbjct: 66 FHGAQVHRH-VHNFREVQQCTLLSIKTGGCSEDCSYCPQSSRYSTGVKAQ 114 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,328,073 Number of Sequences: 28952 Number of extensions: 155933 Number of successful extensions: 411 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 411 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 683042040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -