BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0789 (543 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25798| Best HMM Match : FA_desaturase (HMM E-Value=0) 110 6e-25 SB_6574| Best HMM Match : eIF-6 (HMM E-Value=1.60028e-42) 29 2.5 SB_19956| Best HMM Match : Vps55 (HMM E-Value=0.65) 27 7.5 SB_4353| Best HMM Match : Vps55 (HMM E-Value=0.65) 27 7.5 >SB_25798| Best HMM Match : FA_desaturase (HMM E-Value=0) Length = 268 Score = 110 bits (265), Expect = 6e-25 Identities = 43/67 (64%), Positives = 55/67 (82%) Frame = +2 Query: 323 FGITAGAHRLWSHNGYKVKLPLEILLMVFNSIAFQNTIFTWVRDHRLHHKYTDTDADPHN 502 +G+T GAHRLW+H +K K PL +++M+ NS+A QN IF W RDHR+HHKY++TDADPHN Sbjct: 18 YGVTIGAHRLWAHRTFKAKWPLRLVIMLMNSMAAQNDIFEWSRDHRVHHKYSETDADPHN 77 Query: 503 ATRGFFF 523 A RGFFF Sbjct: 78 AKRGFFF 84 >SB_6574| Best HMM Match : eIF-6 (HMM E-Value=1.60028e-42) Length = 618 Score = 29.1 bits (62), Expect = 2.5 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +2 Query: 203 MNVIRFSYLHIAGLYGLYLCFTSAKLATSVFAI 301 MN +F YL++ G+ GL+ F +A ++ VF + Sbjct: 284 MNGKKFKYLYVTGVAGLFWGFLAAAVSCCVFYV 316 >SB_19956| Best HMM Match : Vps55 (HMM E-Value=0.65) Length = 402 Score = 27.5 bits (58), Expect = 7.5 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 203 MNVIRFSYLHIAGLYGLYLCFTSAKLATSVFAI 301 MN F YL++ G+ GL+ F + ++ VF + Sbjct: 126 MNGTEFKYLYVTGVAGLFWGFLATAVSCCVFYV 158 >SB_4353| Best HMM Match : Vps55 (HMM E-Value=0.65) Length = 336 Score = 27.5 bits (58), Expect = 7.5 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 203 MNVIRFSYLHIAGLYGLYLCFTSAKLATSVFAI 301 MN F YL++ G+ GL+ F + ++ VF + Sbjct: 126 MNGTEFKYLYVTGVAGLFWGFLATAVSCCVFYV 158 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,883,373 Number of Sequences: 59808 Number of extensions: 320684 Number of successful extensions: 858 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 814 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 858 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1239956166 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -