BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0786 (445 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 23 1.5 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 22 2.6 EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isome... 21 4.6 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 4.6 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 6.1 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 23.0 bits (47), Expect = 1.5 Identities = 15/51 (29%), Positives = 22/51 (43%), Gaps = 3/51 (5%) Frame = +2 Query: 95 CLHAQYKNACQNGALTGQVSPSSQNTNITRHQSLW---TFIRIRGTKSLQQ 238 C++ Q N C G L G + P + S + TF+R G S+ Q Sbjct: 185 CIYVQSINLCMAGRLFGYLCPGMALSQFDLMGSPYRNLTFVRREGEFSVLQ 235 Score = 20.6 bits (41), Expect = 8.0 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = -2 Query: 132 PFWQAFLYC 106 P W+ FLYC Sbjct: 424 PKWRQFLYC 432 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 22.2 bits (45), Expect = 2.6 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -2 Query: 372 CSARKVFKQITIIIEEILNFEQQTALIVSEQID 274 CS V IT + + + F ++ AL +SE ++ Sbjct: 135 CSVNDVNMTITELTDPVKEFWERRALQISEGVE 167 >EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isomerase protein. Length = 247 Score = 21.4 bits (43), Expect = 4.6 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +2 Query: 74 NRLHTSVCLHAQYKNACQNGALTGQVSPS 160 N L ++ + Q GA TG++SP+ Sbjct: 52 NILPNNISIAGQNTYKVAKGAFTGEISPA 80 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.4 bits (43), Expect = 4.6 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +1 Query: 241 SASQKESWAAAIDLLTNDECRLLLEVEDFFNDDCDLLKN 357 S SQ+++ AA ++ DE RLL V D CD ++ Sbjct: 161 SRSQEKAVAAELE----DEQRLLATVVQAHLDTCDFTRD 195 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.0 bits (42), Expect = 6.1 Identities = 8/12 (66%), Positives = 11/12 (91%) Frame = -1 Query: 103 VKAHAGVQTIRY 68 VKA +GVQT+R+ Sbjct: 59 VKAISGVQTVRF 70 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,886 Number of Sequences: 438 Number of extensions: 2133 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11574126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -