BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0784 (547 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 23 1.5 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 23 2.7 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 23 2.7 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 23 2.7 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 23.4 bits (48), Expect = 1.5 Identities = 8/34 (23%), Positives = 20/34 (58%) Frame = -2 Query: 180 KLHCIYFTWYLWVMLMRVTVLSALLYVKLLRLGY 79 KL + F W + +++ + ++S ++Y+ + L Y Sbjct: 391 KLVLLNFGWQMICLIVVIALVSIIMYIAFIILQY 424 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 22.6 bits (46), Expect = 2.7 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 282 VFIECYYSFFLKYV 241 VF+ C+ FFL YV Sbjct: 335 VFVVCWLPFFLMYV 348 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 22.6 bits (46), Expect = 2.7 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 282 VFIECYYSFFLKYV 241 VF+ C+ FFL YV Sbjct: 335 VFVVCWLPFFLMYV 348 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 22.6 bits (46), Expect = 2.7 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -2 Query: 282 VFIECYYSFFLKYV 241 VF+ C+ FFL YV Sbjct: 335 VFVVCWLPFFLMYV 348 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,904 Number of Sequences: 438 Number of extensions: 2661 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15581757 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -