BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0783 (473 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12441| Best HMM Match : Ribosomal_L18p (HMM E-Value=0) 81 6e-16 SB_35225| Best HMM Match : Ribosomal_L18p (HMM E-Value=4e-30) 76 2e-14 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.65 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.0 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_11523| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_43459| Best HMM Match : VWA (HMM E-Value=1.8e-23) 28 3.4 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_54131| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_4647| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_16955| Best HMM Match : SLAP (HMM E-Value=0.048) 28 4.5 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 28 4.5 SB_3957| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.5 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) 27 6.0 SB_41319| Best HMM Match : NACHT (HMM E-Value=5.2e-14) 27 6.0 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_29875| Best HMM Match : PHD (HMM E-Value=0.0014) 27 6.0 SB_13736| Best HMM Match : PHD (HMM E-Value=0.001) 27 6.0 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) 27 6.0 SB_53096| Best HMM Match : PHD (HMM E-Value=0.001) 27 6.0 SB_49455| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_46260| Best HMM Match : CUB (HMM E-Value=7.3e-24) 27 6.0 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_29292| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_25649| Best HMM Match : Trypsin (HMM E-Value=0) 27 6.0 SB_12041| Best HMM Match : PHD (HMM E-Value=0.001) 27 6.0 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 27 6.0 SB_58313| Best HMM Match : UPF0180 (HMM E-Value=3.4) 27 7.9 SB_57657| Best HMM Match : PHD (HMM E-Value=0.0012) 27 7.9 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_17985| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_40061| Best HMM Match : PHD (HMM E-Value=0.015) 27 7.9 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_6963| Best HMM Match : PHD (HMM E-Value=0.054) 27 7.9 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_3601| Best HMM Match : DUF765 (HMM E-Value=3.9) 27 7.9 >SB_12441| Best HMM Match : Ribosomal_L18p (HMM E-Value=0) Length = 328 Score = 80.6 bits (190), Expect = 6e-16 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +3 Query: 135 RRREGKTDYYARKRLVVQDKNKYNTPKYRLIVRLSNKDVTCQ 260 RR +GKTDYYARKRL+ QDKNKYNTPKYR +VR++NKD+ CQ Sbjct: 17 RRSQGKTDYYARKRLITQDKNKYNTPKYRFVVRITNKDIICQ 58 >SB_35225| Best HMM Match : Ribosomal_L18p (HMM E-Value=4e-30) Length = 113 Score = 75.8 bits (178), Expect = 2e-14 Identities = 36/70 (51%), Positives = 42/70 (60%) Frame = +3 Query: 261 VAYSRIEGDHIVCAAYSHELPRYGVKVGLTNYAAAYSTGXXXXXXXXXXXXXXXXXXXXX 440 +AY+++EGD I+CAAY+HELPRYGVKVGLTNYAAAY TG Sbjct: 1 IAYAKLEGDVIICAAYAHELPRYGVKVGLTNYAAAYCTGLLLARRLLTKLNLHEIYTGTE 60 Query: 441 XXXXXEYNVE 470 EYNVE Sbjct: 61 EVNGDEYNVE 70 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 30.7 bits (66), Expect = 0.65 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -3 Query: 48 GVHRRLVPNSCSPGDP 1 G HR L NSCSPGDP Sbjct: 32 GEHRVLTSNSCSPGDP 47 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 29.5 bits (63), Expect = 1.5 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = -3 Query: 96 SSQL*RIPYFKSKLQSGVHRRLVPNSCSPGDP 1 +S+L ++ +S +S + + V NSCSPGDP Sbjct: 1044 TSELEKLRLERSAKKSELEEKEVSNSCSPGDP 1075 >SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 29.1 bits (62), Expect = 2.0 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 2/25 (8%) Frame = -3 Query: 69 FKSKLQSGVHRRL--VPNSCSPGDP 1 FK L + RRL + NSCSPGDP Sbjct: 101 FKHGLIPSIKRRLLGISNSCSPGDP 125 >SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.1 bits (62), Expect = 2.0 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -3 Query: 48 GVHRRLVPNSCSPGDP 1 G+H + NSCSPGDP Sbjct: 8 GLHSQTTSNSCSPGDP 23 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 28.7 bits (61), Expect = 2.6 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 Query: 66 KSKLQSGVHRRLVPNSCSPGDP 1 K KL++ + NSCSPGDP Sbjct: 35 KKKLKASKKNFFISNSCSPGDP 56 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 28.7 bits (61), Expect = 2.6 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 Query: 60 KLQSGVHRRLVPNSCSPGDP 1 K V+R V NSCSPGDP Sbjct: 5 KFPGAVNRDEVSNSCSPGDP 24 >SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 28.7 bits (61), Expect = 2.6 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -3 Query: 57 LQSGVHRRLVPNSCSPGDP 1 + SG++ + NSCSPGDP Sbjct: 76 IHSGLNEHSLSNSCSPGDP 94 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.7 bits (61), Expect = 2.6 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 36 RLVPNSCSPGDP 1 RLV NSCSPGDP Sbjct: 25 RLVSNSCSPGDP 36 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.7 bits (61), Expect = 2.6 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -3 Query: 57 LQSGVHRRLVPNSCSPGDP 1 L+S V L+ NSCSPGDP Sbjct: 26 LRSTVSISLISNSCSPGDP 44 >SB_11523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 28.7 bits (61), Expect = 2.6 Identities = 12/27 (44%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +3 Query: 222 LIVRLSNKDVTCQVAYSRIEGD-HIVC 299 L++ LS +D+TC V YS G+ H +C Sbjct: 108 LLLYLSKRDITCPVPYSSRNGELHTMC 134 >SB_43459| Best HMM Match : VWA (HMM E-Value=1.8e-23) Length = 232 Score = 28.3 bits (60), Expect = 3.4 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = -1 Query: 158 ISFPFTTPLEFYLVPLEVLFVLHNFNESHILNLSYK 51 ISFPFTT E Y +V F+ N LNL+ + Sbjct: 119 ISFPFTTRKEAYRQLSKVPFIAGTTNTQEALNLAQR 154 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 28.3 bits (60), Expect = 3.4 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -3 Query: 45 VHRRLVPNSCSPGDP 1 V R L+ NSCSPGDP Sbjct: 58 VSRTLLSNSCSPGDP 72 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 28.3 bits (60), Expect = 3.4 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Frame = -3 Query: 72 YFKSKLQSGVHRRL--VPNSCSPGDP 1 Y + KLQ + + V NSCSPGDP Sbjct: 24 YIREKLQGYIREFVLRVSNSCSPGDP 49 >SB_54131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3160 Score = 28.3 bits (60), Expect = 3.4 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +3 Query: 270 SRIEGDHIVCAAYSH-ELPRYGVKVGLTNYAAAY 368 ++ GDH+ A+YSH ++ R+ V + L AAY Sbjct: 133 AKYRGDHLDIASYSHQQIDRFAVLLDLWTNEAAY 166 >SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 3.4 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -3 Query: 69 FKSKLQSGVHRRLVPNSCSPGDP 1 FK+ +R + NSCSPGDP Sbjct: 22 FKATTSLVYYRSITSNSCSPGDP 44 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 28.3 bits (60), Expect = 3.4 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 3 DPPGCRNSARGVCGRHFVT 59 DPPGCRNS G C R+ + Sbjct: 17 DPPGCRNSIEG-CNRNLTS 34 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 28.3 bits (60), Expect = 3.4 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 39 RRLVPNSCSPGDP 1 +R+V NSCSPGDP Sbjct: 83 QRIVSNSCSPGDP 95 >SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 27.9 bits (59), Expect = 4.5 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 42 HRRLVPNSCSPGDP 1 H+R NSCSPGDP Sbjct: 38 HKRSSSNSCSPGDP 51 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.9 bits (59), Expect = 4.5 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 39 RRLVPNSCSPGDP 1 R LV NSCSPGDP Sbjct: 15 RLLVSNSCSPGDP 27 >SB_4647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2735 Score = 27.9 bits (59), Expect = 4.5 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +3 Query: 90 VKNKQYFKRYQVKFKRRREGKTDYYARKRLVV 185 VK+K+ KR K KR+ + K+D + RK+ ++ Sbjct: 228 VKHKRKQKRKSAKHKRKHKRKSDKHKRKQTLI 259 >SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.9 bits (59), Expect = 4.5 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 42 HRRLVPNSCSPGDP 1 H++ + NSCSPGDP Sbjct: 8 HKKSLSNSCSPGDP 21 >SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 27.9 bits (59), Expect = 4.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 Query: 66 KSKLQSGVHRRLVPNSCSPGDP 1 K ++ S V + NSCSPGDP Sbjct: 34 KKRVLSAVFETVPSNSCSPGDP 55 >SB_16955| Best HMM Match : SLAP (HMM E-Value=0.048) Length = 1952 Score = 27.9 bits (59), Expect = 4.5 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +3 Query: 75 GFVKVVKNKQYFKRYQVKFKRRREGKTDY 161 GF++ +K + RY VK R R DY Sbjct: 1090 GFIEALKRRDVSSRYNVKHARFRRATNDY 1118 >SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) Length = 144 Score = 27.9 bits (59), Expect = 4.5 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 78 IPYFKSKLQSGVHRRLVPNSCSPGDP 1 +P +K K+ V + NSCSPGDP Sbjct: 6 VPVYKIKMSRKVS--ITSNSCSPGDP 29 >SB_3957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.9 bits (59), Expect = 4.5 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -3 Query: 63 SKLQSGVHRRLVPNSCSPGDP 1 S+L ++R+ NSCSPGDP Sbjct: 5 SRLLLQTYQRVESNSCSPGDP 25 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 27.5 bits (58), Expect = 6.0 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 3 DPPGCRNSARGVCGR 47 DPPGCRNS G GR Sbjct: 17 DPPGCRNSMIGSGGR 31 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.5 bits (58), Expect = 6.0 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -3 Query: 36 RLVPNSCSPGDP 1 R++ NSCSPGDP Sbjct: 16 RIISNSCSPGDP 27 >SB_42238| Best HMM Match : Trypsin (HMM E-Value=0) Length = 657 Score = 27.5 bits (58), Expect = 6.0 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 228 VRLSNKDVTCQVAYSRIEGDHIVCAAY 308 VRL ++D TC +YS I + +CA Y Sbjct: 405 VRLVSRD-TCNASYSGIINERYICAGY 430 >SB_41319| Best HMM Match : NACHT (HMM E-Value=5.2e-14) Length = 961 Score = 27.5 bits (58), Expect = 6.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 296 VRCLFT*VATLWCEGWSDKLCCSIFNWSAISTKTASKTW 412 V+C + +C+ W CCSI N S + +S +W Sbjct: 91 VKCNQKGIQCDYCDAWYHTKCCSISNESYNTLANSSCSW 129 >SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 6.0 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 3/25 (12%) Frame = -3 Query: 66 KSKLQSGVHRRLV---PNSCSPGDP 1 KSK S VH R + NSCSPG+P Sbjct: 2 KSKSASRVHYRKIVSISNSCSPGEP 26 >SB_29875| Best HMM Match : PHD (HMM E-Value=0.0014) Length = 598 Score = 27.5 bits (58), Expect = 6.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 296 VRCLFT*VATLWCEGWSDKLCCSIFNWSAISTKTASKTW 412 V+C + +C+ W CCSI N S + +S +W Sbjct: 104 VKCNQKGIQCDYCDAWYHTKCCSISNESYNTLANSSCSW 142 >SB_13736| Best HMM Match : PHD (HMM E-Value=0.001) Length = 226 Score = 27.5 bits (58), Expect = 6.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 296 VRCLFT*VATLWCEGWSDKLCCSIFNWSAISTKTASKTW 412 V+C + +C+ W CCSI N S + +S +W Sbjct: 60 VKCNQKGIQCDYCDAWYHTKCCSISNESYNTLANSSCSW 98 >SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 27.5 bits (58), Expect = 6.0 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -3 Query: 66 KSKLQSGVHRRLVPNSCSPGDP 1 K K ++ V R NSCSPGDP Sbjct: 90 KVKKKNAVTRIRTSNSCSPGDP 111 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.5 bits (58), Expect = 6.0 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -3 Query: 72 YFKSKLQSGVHRRLVPNSCSPGDP 1 + + +S R L NSCSPGDP Sbjct: 1 FLDANRKSNASRTLRSNSCSPGDP 24 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 27.5 bits (58), Expect = 6.0 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 36 RLVPNSCSPGDP 1 R+V NSCSPGDP Sbjct: 3473 RVVSNSCSPGDP 3484 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.5 bits (58), Expect = 6.0 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 39 RRLVPNSCSPGDP 1 R LV NSCSPGDP Sbjct: 7 RILVSNSCSPGDP 19 >SB_55181| Best HMM Match : DVL (HMM E-Value=6.1) Length = 175 Score = 27.5 bits (58), Expect = 6.0 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -2 Query: 58 VTKWRPQTPRAEFLQPGGS 2 V K+ + P+ EFLQPGGS Sbjct: 42 VFKYELKAPKIEFLQPGGS 60 >SB_53096| Best HMM Match : PHD (HMM E-Value=0.001) Length = 623 Score = 27.5 bits (58), Expect = 6.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 296 VRCLFT*VATLWCEGWSDKLCCSIFNWSAISTKTASKTW 412 V+C + +C+ W CCSI N S + +S +W Sbjct: 60 VKCNQKGIQCDYCDAWYHTKCCSISNESYNTLANSSCSW 98 >SB_49455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 897 Score = 27.5 bits (58), Expect = 6.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 296 VRCLFT*VATLWCEGWSDKLCCSIFNWSAISTKTASKTW 412 V+C + +C+ W CCSI N S + +S +W Sbjct: 359 VKCNQKGIQCDYCDAWYHTKCCSISNESYNTLANSSCSW 397 >SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 27.5 bits (58), Expect = 6.0 Identities = 12/23 (52%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = -3 Query: 66 KSKLQSGVHRRLVP-NSCSPGDP 1 K + + G H ++P NSCSPGDP Sbjct: 53 KRESRVGHHTPILPSNSCSPGDP 75 >SB_46260| Best HMM Match : CUB (HMM E-Value=7.3e-24) Length = 830 Score = 27.5 bits (58), Expect = 6.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 296 VRCLFT*VATLWCEGWSDKLCCSIFNWSAISTKTASKTW 412 V+C + +C+ W CCSI N S + +S +W Sbjct: 645 VKCNQKGIQCDYCDAWYHTKCCSISNESYNTLANSSCSW 683 >SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 27.5 bits (58), Expect = 6.0 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 42 HRRLVPNSCSPGDP 1 H R + NSCSPGDP Sbjct: 52 HVRALSNSCSPGDP 65 >SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.5 bits (58), Expect = 6.0 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -3 Query: 63 SKLQSGVHRRLVPNSCSPGDP 1 +K++ H + NSCSPGDP Sbjct: 15 NKIKETRHLQAASNSCSPGDP 35 >SB_29292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 717 Score = 27.5 bits (58), Expect = 6.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 296 VRCLFT*VATLWCEGWSDKLCCSIFNWSAISTKTASKTW 412 V+C + +C+ W CCSI N S + +S +W Sbjct: 184 VKCNQKGIQCDYCDAWYHTKCCSISNESYNTLANSSCSW 222 >SB_25649| Best HMM Match : Trypsin (HMM E-Value=0) Length = 718 Score = 27.5 bits (58), Expect = 6.0 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +3 Query: 228 VRLSNKDVTCQVAYSRIEGDHIVCAAY 308 VRL ++D TC +YS I + +CA Y Sbjct: 690 VRLVSRD-TCNASYSGIINERYICAGY 715 >SB_12041| Best HMM Match : PHD (HMM E-Value=0.001) Length = 560 Score = 27.5 bits (58), Expect = 6.0 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 296 VRCLFT*VATLWCEGWSDKLCCSIFNWSAISTKTASKTW 412 V+C + +C+ W CCSI N S + +S +W Sbjct: 23 VKCNQKGIQCDYCDAWYHTKCCSISNESYNTLANSSCSW 61 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 27.5 bits (58), Expect = 6.0 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -3 Query: 45 VHRRLVPNSCSPGDP 1 + R L NSCSPGDP Sbjct: 92 IKRALASNSCSPGDP 106 >SB_58313| Best HMM Match : UPF0180 (HMM E-Value=3.4) Length = 478 Score = 27.1 bits (57), Expect = 7.9 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = +2 Query: 32 RRLWTPLCNLDLKY 73 RR+W P+C++ LKY Sbjct: 421 RRVWLPVCSISLKY 434 >SB_57657| Best HMM Match : PHD (HMM E-Value=0.0012) Length = 363 Score = 27.1 bits (57), Expect = 7.9 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 296 VRCLFT*VATLWCEGWSDKLCCSIFNWSAISTKTASKTW 412 V+C + +C+ W CCSI N S + +S +W Sbjct: 60 VKCNQKGIQCDYCDAWYHTNCCSISNESYNTLANSSCSW 98 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.1 bits (57), Expect = 7.9 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 Query: 54 QSGVHRRLVPNSCSPGDP 1 +S V L+ NSCSPGDP Sbjct: 26 RSTVSISLISNSCSPGDP 43 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.1 bits (57), Expect = 7.9 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -3 Query: 72 YFKSKLQSGVHRRLVPNSCSPGDP 1 Y + + S + L NSCSPGDP Sbjct: 7 YLRIEFLSNPPKNLRSNSCSPGDP 30 >SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.1 bits (57), Expect = 7.9 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -3 Query: 48 GVHRRLVPNSCSPGDP 1 G+ R ++ NSCSPGDP Sbjct: 10 GLIRPVLSNSCSPGDP 25 >SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 27.1 bits (57), Expect = 7.9 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 42 HRRLVPNSCSPGDP 1 H R+ NSCSPGDP Sbjct: 52 HCRVPSNSCSPGDP 65 >SB_17985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 818 Score = 27.1 bits (57), Expect = 7.9 Identities = 15/71 (21%), Positives = 37/71 (52%) Frame = +3 Query: 84 KVVKNKQYFKRYQVKFKRRREGKTDYYARKRLVVQDKNKYNTPKYRLIVRLSNKDVTCQV 263 K +K+ Q+ V+F+ +E + D + R + ++QD N T + ++++ N+ ++ Sbjct: 400 KTMKSMQFKNEELVRFQYNQEDQVDDFKRLKKLIQD-NGLPTIEQVIVLQRQNESYREEL 458 Query: 264 AYSRIEGDHIV 296 R E + ++ Sbjct: 459 MNERKEKERLL 469 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.1 bits (57), Expect = 7.9 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 Query: 54 QSGVHRRLVPNSCSPGDP 1 +S V L+ NSCSPGDP Sbjct: 26 RSTVSISLISNSCSPGDP 43 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.1 bits (57), Expect = 7.9 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 Query: 54 QSGVHRRLVPNSCSPGDP 1 +S V L+ NSCSPGDP Sbjct: 26 RSTVSISLISNSCSPGDP 43 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.1 bits (57), Expect = 7.9 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 Query: 54 QSGVHRRLVPNSCSPGDP 1 +S V L+ NSCSPGDP Sbjct: 26 RSTVSISLISNSCSPGDP 43 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.1 bits (57), Expect = 7.9 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 Query: 54 QSGVHRRLVPNSCSPGDP 1 +S V L+ NSCSPGDP Sbjct: 26 RSTVSISLISNSCSPGDP 43 >SB_40061| Best HMM Match : PHD (HMM E-Value=0.015) Length = 260 Score = 27.1 bits (57), Expect = 7.9 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 296 VRCLFT*VATLWCEGWSDKLCCSIFNWSAISTKTASKTW 412 V+C + +C+ W CCSI N S + +S +W Sbjct: 104 VKCNQKGIQRDYCDAWYHTKCCSISNDSYNTLANSSCSW 142 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 27.1 bits (57), Expect = 7.9 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -3 Query: 39 RRLVPNSCSPGDP 1 + L+ NSCSPGDP Sbjct: 38 KHLISNSCSPGDP 50 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.1 bits (57), Expect = 7.9 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 Query: 54 QSGVHRRLVPNSCSPGDP 1 +S V L+ NSCSPGDP Sbjct: 26 RSTVSISLISNSCSPGDP 43 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 27.1 bits (57), Expect = 7.9 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -3 Query: 45 VHRRLVPNSCSPGDP 1 V +++V NSCSPGDP Sbjct: 23 VIQKVVSNSCSPGDP 37 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.1 bits (57), Expect = 7.9 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 Query: 54 QSGVHRRLVPNSCSPGDP 1 +S V L+ NSCSPGDP Sbjct: 26 RSTVSISLISNSCSPGDP 43 >SB_6963| Best HMM Match : PHD (HMM E-Value=0.054) Length = 146 Score = 27.1 bits (57), Expect = 7.9 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +2 Query: 329 WCEGWSDKLCCSIFNWSAISTKTASKTW 412 +C+ W CCSI N S + +S +W Sbjct: 115 YCDAWYHTKCCSISNESYNTLANSSCSW 142 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.1 bits (57), Expect = 7.9 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -3 Query: 42 HRRLVPNSCSPGDP 1 H ++ NSCSPGDP Sbjct: 22 HNIVISNSCSPGDP 35 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 27.1 bits (57), Expect = 7.9 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 Query: 54 QSGVHRRLVPNSCSPGDP 1 +S V L+ NSCSPGDP Sbjct: 24 RSTVSISLISNSCSPGDP 41 >SB_3601| Best HMM Match : DUF765 (HMM E-Value=3.9) Length = 146 Score = 27.1 bits (57), Expect = 7.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = -3 Query: 48 GVHRRLVPNSCSPGDP 1 G H NSCSPGDP Sbjct: 16 GAHNMAGSNSCSPGDP 31 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,856,642 Number of Sequences: 59808 Number of extensions: 320406 Number of successful extensions: 2401 Number of sequences better than 10.0: 69 Number of HSP's better than 10.0 without gapping: 2328 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2401 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 994359969 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -