BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0782 (618 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q6KIH6 Cluster: Putative amino acid permease; n=1; Myco... 37 0.33 UniRef50_A5DHN4 Cluster: Putative uncharacterized protein; n=1; ... 35 1.4 UniRef50_Q18A73 Cluster: Putative membrane protein; n=1; Clostri... 33 5.5 UniRef50_A6PF65 Cluster: Putative uncharacterized protein precur... 33 5.5 UniRef50_Q4A8Y8 Cluster: ABC transporter ATP-binding protein; n=... 32 9.5 >UniRef50_Q6KIH6 Cluster: Putative amino acid permease; n=1; Mycoplasma mobile|Rep: Putative amino acid permease - Mycoplasma mobile Length = 538 Score = 37.1 bits (82), Expect = 0.33 Identities = 20/54 (37%), Positives = 31/54 (57%) Frame = -3 Query: 595 NNFALLGFVRKLDSV*NLDRILFSFVFVYMAFVFLIPLLEFIFKKFCEIMNRHI 434 +N A LG K +S+ N+D I+ +F+F ++ FL+P + F KF E N I Sbjct: 453 SNSAGLGVFVKTNSIKNIDYIIMNFIF--LSIFFLLPTINFFLIKFFEKRNAFI 504 >UniRef50_A5DHN4 Cluster: Putative uncharacterized protein; n=1; Pichia guilliermondii|Rep: Putative uncharacterized protein - Pichia guilliermondii (Yeast) (Candida guilliermondii) Length = 251 Score = 35.1 bits (77), Expect = 1.4 Identities = 18/53 (33%), Positives = 29/53 (54%) Frame = +3 Query: 324 FFYDPYHLSRKRFTTIIWFVFHVHIYMFPDTSVLVKSICLFIISQNFLKINSS 482 FF+ P SRK ++ FH IY DTS+ + I L ++++N K+ S+ Sbjct: 136 FFFFPRLCSRKGSKSLTNLCFHRSIYFLVDTSMPISFISLELVAKNLSKLPSN 188 >UniRef50_Q18A73 Cluster: Putative membrane protein; n=1; Clostridium difficile 630|Rep: Putative membrane protein - Clostridium difficile (strain 630) Length = 148 Score = 33.1 bits (72), Expect = 5.5 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 3/86 (3%) Frame = +3 Query: 366 TIIWFVFHVHIYMFPDT---SVLVKSICLFIISQNFLKINSSRGIKKTKAMYTNTKLNKI 536 T+IWF I +F + S+ ++ + +IS L + + + +KK K +NT L + Sbjct: 23 TLIWFSVGAVILIFLSSFIESIFLQILIFAVISIAMLVVATKKIVKKDKGYKSNTNLQAM 82 Query: 537 LSKFQTLSSFLTKPNKAKLF*YRRET 614 +SK ++ ++ PN L ET Sbjct: 83 MSKKGIVTEEIS-PNNTGLVVVEHET 107 >UniRef50_A6PF65 Cluster: Putative uncharacterized protein precursor; n=1; Shewanella sediminis HAW-EB3|Rep: Putative uncharacterized protein precursor - Shewanella sediminis HAW-EB3 Length = 242 Score = 33.1 bits (72), Expect = 5.5 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 46 IIYLDTKPYLFYPSFNPITGIYAMVKQLC 132 ++YL K LFY S+N +TGI + LC Sbjct: 138 LVYLSMKGRLFYSSWNAVTGILTFISFLC 166 >UniRef50_Q4A8Y8 Cluster: ABC transporter ATP-binding protein; n=6; Mycoplasma hyopneumoniae|Rep: ABC transporter ATP-binding protein - Mycoplasma hyopneumoniae (strain 7448) Length = 775 Score = 32.3 bits (70), Expect = 9.5 Identities = 11/27 (40%), Positives = 21/27 (77%) Frame = -3 Query: 544 LDRILFSFVFVYMAFVFLIPLLEFIFK 464 LD ++ SFV +++ FVF++P++ I+K Sbjct: 697 LDLLILSFVVLFLGFVFIVPIVPEIYK 723 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 575,435,860 Number of Sequences: 1657284 Number of extensions: 10988000 Number of successful extensions: 23808 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 22808 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23793 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 44807090004 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -