BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0780 (530 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB24D3.02c |||amino acid permease, unknown 3|Schizosaccharomy... 25 9.3 SPCC1393.11 |||mitochondrial ribosomal protein subunit L20|Schiz... 25 9.3 >SPAPB24D3.02c |||amino acid permease, unknown 3|Schizosaccharomyces pombe|chr 1|||Manual Length = 543 Score = 24.6 bits (51), Expect = 9.3 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +2 Query: 335 VSALRMTRAECCTGASRSPAAWSPKDYDSGEIFFYKVLSGGVPCNA 472 + AL + C +SR A++ G F K+ GG+P NA Sbjct: 343 IIALCFNCSALCLASSREIFAFARDKGLPGSWIFRKLTPGGIPLNA 388 >SPCC1393.11 |||mitochondrial ribosomal protein subunit L20|Schizosaccharomyces pombe|chr 3|||Manual Length = 197 Score = 24.6 bits (51), Expect = 9.3 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 3/34 (8%) Frame = -1 Query: 452 PREPCRRI---FRRYRNPWGSRRREIERPQYSIQ 360 P+E +++ F + WGS++REI R + S Q Sbjct: 153 PKERIQKVEENFEAEKLAWGSKKREIRRQRASRQ 186 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,809,849 Number of Sequences: 5004 Number of extensions: 28174 Number of successful extensions: 65 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 218398248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -