BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0778 (599 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40952-6|AAA81740.3| 328|Caenorhabditis elegans Hypothetical pr... 29 2.5 AF000191-4|AAB52881.2| 362|Caenorhabditis elegans Hypothetical ... 28 4.4 >U40952-6|AAA81740.3| 328|Caenorhabditis elegans Hypothetical protein C03B1.5 protein. Length = 328 Score = 29.1 bits (62), Expect = 2.5 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +1 Query: 277 CEYKKSCTKIMTYTWFELKKNIVFINILLCYSFQ 378 C+Y K ++ T+T N++FI + C +FQ Sbjct: 69 CDYHKIIREVNTHTLCRHHDNVLFIGSIYCQTFQ 102 >AF000191-4|AAB52881.2| 362|Caenorhabditis elegans Hypothetical protein T23C6.5 protein. Length = 362 Score = 28.3 bits (60), Expect = 4.4 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = -1 Query: 293 DFLYSHHFMYYIYKVVIVSYLYVLQLITNLEFDL*FRVIVKVE-FVAIFVAM*VNLVFN 120 +F++ H + KV+ SY+YVL I N+ + V+V VE +A+ + V F+ Sbjct: 73 NFVFQGHGRWPFGKVLCYSYIYVLHFIPNVSAGI--LVLVSVERLIAVLRPLRVRRAFS 129 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,984,150 Number of Sequences: 27780 Number of extensions: 207767 Number of successful extensions: 441 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 430 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 441 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1279376318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -