BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0776 (587 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25798| Best HMM Match : FA_desaturase (HMM E-Value=0) 133 1e-31 SB_42121| Best HMM Match : EGF_CA (HMM E-Value=8.7) 75 4e-14 SB_2286| Best HMM Match : Cu_bind_like (HMM E-Value=6.6) 30 1.6 SB_49228| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_45746| Best HMM Match : FA_desaturase (HMM E-Value=0) 29 2.1 SB_31018| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_1252| Best HMM Match : POPLD (HMM E-Value=1.9) 29 2.1 SB_12718| Best HMM Match : rve (HMM E-Value=0.0031) 29 2.8 SB_41005| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_36820| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_12139| Best HMM Match : Autotransporter (HMM E-Value=1.4) 29 3.7 SB_36213| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.033) 28 4.9 SB_14471| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_3750| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_1754| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_346| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_58932| Best HMM Match : POPLD (HMM E-Value=0.9) 28 6.5 SB_55640| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_43216| Best HMM Match : RSD-2 (HMM E-Value=2.3) 28 6.5 SB_29676| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_22139| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_9409| Best HMM Match : HLH (HMM E-Value=5.8e-17) 28 6.5 SB_4086| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_56700| Best HMM Match : rve (HMM E-Value=1.1e-11) 27 8.6 SB_44331| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_30991| Best HMM Match : DUF11 (HMM E-Value=2.9) 27 8.6 SB_24712| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_58631| Best HMM Match : DUF548 (HMM E-Value=3.7) 27 8.6 SB_50077| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_22331| Best HMM Match : fn3 (HMM E-Value=7.1e-14) 27 8.6 >SB_25798| Best HMM Match : FA_desaturase (HMM E-Value=0) Length = 268 Score = 133 bits (321), Expect = 1e-31 Identities = 65/145 (44%), Positives = 89/145 (61%), Gaps = 1/145 (0%) Frame = +2 Query: 2 ALLRFQKKYAIPFIGTICFIIPTLAPMYFWGESLNNAWHIT-VLRYIFSLNGTFLVNSAA 178 +++ FQ+++ +C +IPTL P WGESL NA+ + LRY+ +LN T+ VNS A Sbjct: 114 SVVMFQRRHYKKISMLMCVLIPTLVPS-LWGESLWNAYFTSFALRYVITLNVTWCVNSIA 172 Query: 179 HLWGYKPYDKSLKATQSGMANAFTFGEGFHNYHHVFPWDYRADELGDRYINLTTRFIDFF 358 H+WG KPYD ++ ++ T GEG+HNYHH FP DY A E G R +N++TR ID + Sbjct: 173 HMWGDKPYDVTINPAENLFVTLATSGEGYHNYHHTFPQDYAASEFGTR-LNMSTRLIDMW 231 Query: 359 AWMGWAYDLKTASTNIIEKRALRTG 433 A MG D K I KR +RTG Sbjct: 232 AAMGLVSDRKVVPKETIRKRMMRTG 256 >SB_42121| Best HMM Match : EGF_CA (HMM E-Value=8.7) Length = 202 Score = 74.9 bits (176), Expect = 4e-14 Identities = 49/121 (40%), Positives = 63/121 (52%), Gaps = 1/121 (0%) Frame = +2 Query: 50 ICFIIPTLAPMYFWGESLNNAWHIT-VLRYIFSLNGTFLVNSAAHLWGYKPYDKSLKATQ 226 +C +IPTL P WGESL NA+ + LRY+ +LN T+ VNS AH+WG KPYD ++ Sbjct: 10 MCVLIPTLVPS-LWGESLWNAYFTSFALRYVITLNVTWCVNSIAHMWGDKPYDVTI---N 65 Query: 227 SGMANAFTFGEGFHNYHHVFPWDYRADELGDRYINLTTRFIDFFAWMGWAYDLKTASTNI 406 G G DY A E G R +N++TR ID +A MG D K Sbjct: 66 PGREPLRYLGN-----------DYAASEFGTR-LNMSTRLIDMWAAMGLVSDRKVVPKET 113 Query: 407 I 409 I Sbjct: 114 I 114 >SB_2286| Best HMM Match : Cu_bind_like (HMM E-Value=6.6) Length = 326 Score = 29.9 bits (64), Expect = 1.6 Identities = 13/29 (44%), Positives = 18/29 (62%), Gaps = 2/29 (6%) Frame = +2 Query: 230 GMANAFTF--GEGFHNYHHVFPWDYRADE 310 G+ + F F GEG+HN H + +D ADE Sbjct: 115 GLGDVFVFYPGEGYHNVHVIRGYDTAADE 143 >SB_49228| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 320 Score = 29.5 bits (63), Expect = 2.1 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = +2 Query: 230 GMANAFTF--GEGFHNYHHVFPWDYRADELG 316 G+ + F F GEG+ N H + +D ADE+G Sbjct: 208 GLGDVFVFYPGEGYRNVHVIRGYDTAADEVG 238 >SB_45746| Best HMM Match : FA_desaturase (HMM E-Value=0) Length = 331 Score = 29.5 bits (63), Expect = 2.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 230 GMANAFTFGEGFHNYHHVFP 289 G N TF G+HN HH FP Sbjct: 247 GPLNYLTFNVGYHNEHHDFP 266 >SB_31018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +2 Query: 185 WGYKPYDKSLKATQSGMANAFTF--GEGFHNYHHVFPWDYRADE 310 +G++P + G+ + F F GEG+ N H + +D ADE Sbjct: 231 FGFRPDFRWKGGRNHGLGDVFVFYPGEGYRNVHVISGYDTAADE 274 >SB_1252| Best HMM Match : POPLD (HMM E-Value=1.9) Length = 566 Score = 29.5 bits (63), Expect = 2.1 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Frame = +2 Query: 194 KPYDKSLKATQSGMANAFTF--GEGFHNYHHVFPWDYRADELGDRYINLTT 340 KP+ + G+ + F F GEG+ N H + +D ADE ++NL T Sbjct: 439 KPHFRWKGGRNHGLGDVFVFYPGEGYRNVHVIRGYDTAADEY-PSHLNLFT 488 >SB_12718| Best HMM Match : rve (HMM E-Value=0.0031) Length = 1667 Score = 29.1 bits (62), Expect = 2.8 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +2 Query: 209 SLKATQSGMANAFTF--GEGFHNYHHVFPWDYRADE 310 S+ G+++ F F GEG+ N H + +D ADE Sbjct: 117 SMGGRNHGLSDVFVFYPGEGYRNVHVILGYDTAADE 152 >SB_41005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 568 Score = 28.7 bits (61), Expect = 3.7 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -2 Query: 280 VMVIVKSFTKSKCICHATLSSFQALIVRFVSPQMSSAIYK 161 V +I+ F K K + T+ + LI F+S SAIY+ Sbjct: 118 VAIIISGFEKVKILFAITMFLWFCLIYMFISAHWGSAIYR 157 >SB_36820| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 3.7 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = +2 Query: 230 GMANAFTF--GEGFHNYHHVFPWDYRADE 310 G+ N F F GEG+ N H + +D ADE Sbjct: 65 GLGNVFVFYPGEGYRNVHVIRGYDTAADE 93 >SB_12139| Best HMM Match : Autotransporter (HMM E-Value=1.4) Length = 751 Score = 28.7 bits (61), Expect = 3.7 Identities = 24/87 (27%), Positives = 37/87 (42%), Gaps = 1/87 (1%) Frame = +2 Query: 77 PMY-FWGESLNNAWHITVLRYIFSLNGTFLVNSAAHLWGYKPYDKSLKATQSGMANAFTF 253 P Y +W + LN A + +++ L L G P+ TQ G F Sbjct: 60 PSYGYWPQQLNFAVWGFLRFHVYFTTRRILYELGVPLPGDSPF------TQKGDVFVFYP 113 Query: 254 GEGFHNYHHVFPWDYRADELGDRYINL 334 GEG+ N H + +D AD+ ++NL Sbjct: 114 GEGYRNVHVIRGYDTAADKYSS-HLNL 139 >SB_36213| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.033) Length = 708 Score = 28.3 bits (60), Expect = 4.9 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 4/53 (7%) Frame = -3 Query: 165 TRKVPLRLKM----YLKTVICQALFKLSPQKYIGANVGMIKHIVPINGIAYFF 19 TR V LRLK Y + + CQ +L+ Q+ + A VG ++H P+ FF Sbjct: 520 TRAVELRLKAQGYNYEEVLECQFDVQLNTQRELRALVGDVEHGKPLEARDAFF 572 >SB_14471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 327 Score = 28.3 bits (60), Expect = 4.9 Identities = 16/55 (29%), Positives = 29/55 (52%) Frame = -2 Query: 307 VCPIIPRKNVMVIVKSFTKSKCICHATLSSFQALIVRFVSPQMSSAIYKKSAIET 143 V P+I NV+ + +++ CHA +S +L+ VS + ++ + AIET Sbjct: 73 VVPLIVLSNVVAPMMEYSRGIRYCHAAISVTISLMFNSVSNLSAISLDRYLAIET 127 >SB_3750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 262 Score = 28.3 bits (60), Expect = 4.9 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = +2 Query: 230 GMANAFTF--GEGFHNYHHVFPWDYRADELGDRY 325 G+ + F F GEG+ N H + +D ADE Y Sbjct: 93 GLGDVFVFYPGEGYRNVHVIRGYDTAADEYPSHY 126 >SB_1754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1521 Score = 28.3 bits (60), Expect = 4.9 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +2 Query: 197 PY-DKSLKATQSGMANAFTFGEGFHNYHHVFPWDYRADE 310 PY D K Q G AF GEG+ N H + +D ADE Sbjct: 181 PYSDTRDKLYQLGDVFAFYPGEGYRNVHVIRGYDTAADE 219 >SB_346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 652 Score = 28.3 bits (60), Expect = 4.9 Identities = 19/63 (30%), Positives = 27/63 (42%), Gaps = 3/63 (4%) Frame = +2 Query: 167 NSAAHLWGYKPYDKSLKATQSGMANAFTFGEGF-HNYHHVFPWDYRADELG--DRYINLT 337 N A W K D QSG+ + FG+G NY F + A E G D ++ + Sbjct: 580 NKTAFKWFKKAADMGNPIGQSGLGLMYMFGKGVDKNYEKAFQYFKMAAEQGWVDGHLQIG 639 Query: 338 TRF 346 T + Sbjct: 640 TMY 642 >SB_58932| Best HMM Match : POPLD (HMM E-Value=0.9) Length = 499 Score = 27.9 bits (59), Expect = 6.5 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Frame = +2 Query: 230 GMANAFTF--GEGFHNYHHVFPWDYRADELGDRYINLTTRFID 352 G+ + F F GEG+ N H + +D ADE ++NL FID Sbjct: 214 GLGDVFVFYPGEGYRNVHVIRGYDTAADEYSS-HLNL---FID 252 >SB_55640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1071 Score = 27.9 bits (59), Expect = 6.5 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -2 Query: 376 SPSH-PCKEIYEPCCQIYVPVPQFVCPIIPR 287 +PS PC E Y PC + Y+P + P R Sbjct: 620 APSQSPCTERYTPCTERYIPCTERYTPCTER 650 >SB_43216| Best HMM Match : RSD-2 (HMM E-Value=2.3) Length = 477 Score = 27.9 bits (59), Expect = 6.5 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = +2 Query: 230 GMANAFTF--GEGFHNYHHVFPWDYRADELGDRYINLTTRFIDFFAWMGWAYD 382 G+ + F F GEG+ N H + +D ADE ++NL F+ GW Y+ Sbjct: 62 GLGDVFVFYSGEGYRNVHVIRGYDTAADEY-PSHLNL-------FSDEGWTYN 106 >SB_29676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 531 Score = 27.9 bits (59), Expect = 6.5 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Frame = +2 Query: 230 GMANAFTF--GEGFHNYHHVFPWDYRADELGDRYINLTTRFID 352 G+ + F F GEG+ N H + +D ADE ++NL FID Sbjct: 314 GLGDVFVFYPGEGYRNVHVIRGYDTAADEYSS-HLNL---FID 352 >SB_22139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1472 Score = 27.9 bits (59), Expect = 6.5 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +2 Query: 191 YKPYDKSLKATQSGMANAFTF--GEGFHNYHHVFPWDYRADELGDRYINL 334 +KP + G+ + F F GEG+ N H + +D ADE ++NL Sbjct: 104 HKPDFRWKGGRNHGLGDVFVFYPGEGYRNVHVIRGYDTAADEYSS-HLNL 152 >SB_9409| Best HMM Match : HLH (HMM E-Value=5.8e-17) Length = 362 Score = 27.9 bits (59), Expect = 6.5 Identities = 15/56 (26%), Positives = 25/56 (44%) Frame = -2 Query: 370 SHPCKEIYEPCCQIYVPVPQFVCPIIPRKNVMVIVKSFTKSKCICHATLSSFQALI 203 +HP +++YE C PV + V + T+S C H++ S + LI Sbjct: 126 THPSEDLYETPCSTPPPVEYISSDCVDPSTVFPYPMNDTQSFCSSHSSDSGKRMLI 181 >SB_4086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2235 Score = 27.9 bits (59), Expect = 6.5 Identities = 16/63 (25%), Positives = 28/63 (44%), Gaps = 4/63 (6%) Frame = +2 Query: 290 WDYRADELGDRYINLTTRFIDFFAWMGWAYDLKTASTN----IIEKRALRTGDGTYKRPN 457 W +DELG ++L+ + +W+ + TAST+ I + LR P+ Sbjct: 842 WRLLSDELGSSMVSLSVATTPYSSWIHSVFSWMTASTSATDPIASLKPLRFATSCRTPPS 901 Query: 458 GMN 466 +N Sbjct: 902 SLN 904 >SB_56700| Best HMM Match : rve (HMM E-Value=1.1e-11) Length = 1140 Score = 27.5 bits (58), Expect = 8.6 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 Query: 221 TQSGMANAFTFGEGFHNYHHVFPWDYRADE 310 TQ G F GEG+ N H + +D ADE Sbjct: 28 TQKGDVFVFYPGEGYRNVHVIRGYDTAADE 57 >SB_44331| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1916 Score = 27.5 bits (58), Expect = 8.6 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = +2 Query: 230 GMANAFTF--GEGFHNYHHVFPWDYRADELGDRY 325 G+ F F GEG+ N H + +D ADE Y Sbjct: 412 GLGYVFVFYPGEGYRNVHVICGYDTAADEYPSHY 445 >SB_30991| Best HMM Match : DUF11 (HMM E-Value=2.9) Length = 707 Score = 27.5 bits (58), Expect = 8.6 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = +2 Query: 191 YKPYDKSLKATQSGMANAFTF--GEGFHNYHHVFPWDYRADELGDRY 325 +KP + G+ + F F GEG+ N H + +D ADE ++ Sbjct: 127 HKPDFRWKGGRNHGLGDVFVFYPGEGYRNVHVIRGYDTAADEYPSQF 173 >SB_24712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = +2 Query: 230 GMANAFTF--GEGFHNYHHVFPWDYRADE 310 G+ + F F GEG+ N H + +D ADE Sbjct: 216 GLGDVFVFYPGEGYRNVHVICSYDTAADE 244 >SB_58631| Best HMM Match : DUF548 (HMM E-Value=3.7) Length = 460 Score = 27.5 bits (58), Expect = 8.6 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = +2 Query: 230 GMANAFTF--GEGFHNYHHVFPWDYRADELGDRYINL 334 G+ + F F GEG+ N H + +D ADE ++NL Sbjct: 216 GLGDVFVFYPGEGYRNVHVIRGYDTAADEYSS-HLNL 251 >SB_50077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 907 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = +2 Query: 215 KATQSGMANAFTF--GEGFHNYHHVFPWDYRADE 310 + + G+ + F F GEG+ N H + +D ADE Sbjct: 158 RRAEHGLGDVFVFYPGEGYRNVHVIRGYDTAADE 191 >SB_22331| Best HMM Match : fn3 (HMM E-Value=7.1e-14) Length = 908 Score = 27.5 bits (58), Expect = 8.6 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = +2 Query: 230 GMANAFTF--GEGFHNYHHVFPWDYRADELGDRYINL 334 G+ + F F GEG+ N H + +D ADE ++NL Sbjct: 696 GLGDVFVFYPGEGYRNVHVIRGYDTAADEYSS-HLNL 731 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,405,109 Number of Sequences: 59808 Number of extensions: 362168 Number of successful extensions: 1060 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 988 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1058 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1422302661 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -