BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0775 (577 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X16662-1|CAA34650.1| 327|Homo sapiens protein ( Human mRNA for ... 41 0.003 BC073755-1|AAH73755.1| 327|Homo sapiens annexin A8 protein. 41 0.003 BC008813-1|AAH08813.3| 276|Homo sapiens ANXA8 protein protein. 41 0.003 BC004376-1|AAH04376.1| 327|Homo sapiens annexin A8-like 1 protein. 41 0.003 AL603965-4|CAH70574.1| 327|Homo sapiens annexin A8-like 2 protein. 41 0.003 AL603965-3|CAH70575.1| 276|Homo sapiens annexin A8-like 2 protein. 41 0.003 AL591684-5|CAH72204.1| 276|Homo sapiens annexin A8 protein. 41 0.003 AL591684-4|CAH72203.1| 327|Homo sapiens annexin A8 protein. 41 0.003 AL391137-2|CAI12204.1| 276|Homo sapiens annexin A8-like 1 protein. 41 0.003 AL391137-1|CAI12203.1| 327|Homo sapiens annexin A8-like 1 protein. 41 0.003 AK223149-1|BAD96869.1| 327|Homo sapiens annexin A8 variant prot... 41 0.003 D00017-1|BAA00013.1| 339|Homo sapiens lipocortin II protein. 40 0.005 BT007432-1|AAP36100.1| 339|Homo sapiens annexin A2 protein. 40 0.005 BC093056-1|AAH93056.1| 339|Homo sapiens ANXA2 protein protein. 40 0.005 BC068065-1|AAH68065.1| 339|Homo sapiens annexin A2 protein. 40 0.005 BC066955-1|AAH66955.2| 357|Homo sapiens ANXA2 protein protein. 40 0.005 BC052567-1|AAH52567.1| 339|Homo sapiens annexin A2 protein. 40 0.005 BC052558-1|AAH52558.1| 339|Homo sapiens annexin A2 protein. 40 0.005 BC023990-1|AAH23990.1| 339|Homo sapiens annexin A2 protein. 40 0.005 BC021114-1|AAH21114.1| 339|Homo sapiens annexin A2 protein. 40 0.005 BC016774-1|AAH16774.1| 339|Homo sapiens annexin A2 protein. 40 0.005 BC015834-1|AAH15834.1| 339|Homo sapiens annexin A2 protein. 40 0.005 BC009564-1|AAH09564.1| 339|Homo sapiens annexin A2 protein. 40 0.005 BC001388-1|AAH01388.1| 339|Homo sapiens annexin A2 protein. 40 0.005 Y00097-1|CAA68286.1| 673|Homo sapiens protein ( Human mRNA for ... 39 0.015 M82809-1|AAA51740.1| 321|Homo sapiens annexin IV (placental ant... 39 0.015 M19383-1|AAC41689.1| 321|Homo sapiens protein PP4-X protein. 39 0.015 J03578-1|AAA35656.1| 673|Homo sapiens protein ( Human calelectr... 39 0.015 D78152-1|BAA11227.1| 321|Homo sapiens annexin IV (carbohydrtate... 39 0.015 D00510-1|BAA00400.1| 673|Homo sapiens calphobindin II protein. 39 0.015 CR407681-1|CAG28609.1| 321|Homo sapiens ANXA4 protein. 39 0.015 BX641114-1|CAE46052.1| 112|Homo sapiens hypothetical protein pr... 39 0.015 BC063672-1|AAH63672.1| 299|Homo sapiens ANXA4 protein protein. 39 0.015 BC017046-1|AAH17046.1| 673|Homo sapiens annexin A6 protein. 39 0.015 BC011659-1|AAH11659.1| 321|Homo sapiens annexin A4 protein. 39 0.015 BC000182-1|AAH00182.1| 321|Homo sapiens annexin A4 protein. 39 0.015 AY453398-1|AAS47515.1| 321|Homo sapiens proliferation-inducing ... 39 0.015 AK130077-1|BAC85290.1| 330|Homo sapiens protein ( Homo sapiens ... 39 0.015 AC019206-1|AAY14864.1| 321|Homo sapiens unknown protein. 39 0.015 AB209457-1|BAD92694.1| 225|Homo sapiens annexin IV variant prot... 39 0.015 J04543-1|AAA36616.1| 466|Homo sapiens protein ( Human synexin m... 37 0.059 CR407686-1|CAG28614.1| 466|Homo sapiens ANXA7 protein. 37 0.059 BT007187-1|AAP35851.1| 466|Homo sapiens annexin A7 protein. 37 0.059 BC002632-1|AAH02632.1| 466|Homo sapiens annexin A7 protein. 37 0.059 AL512656-2|CAI15291.1| 466|Homo sapiens annexin A7 protein. 37 0.059 AL512656-1|CAI15290.1| 488|Homo sapiens annexin A7 protein. 37 0.059 AL353731-4|CAI52485.1| 466|Homo sapiens annexin A7 protein. 37 0.059 AL353731-3|CAI52484.1| 488|Homo sapiens annexin A7 protein. 37 0.059 AK222552-1|BAD96272.1| 466|Homo sapiens annexin VII isoform 1 v... 37 0.059 AK126836-1|BAC86715.1| 509|Homo sapiens protein ( Homo sapiens ... 37 0.059 AB062429-1|BAB93492.1| 466|Homo sapiens annexin A7 protein. 37 0.059 Z11502-1|CAA77578.1| 316|Homo sapiens intestine-specific annexi... 36 0.10 M63310-1|AAA52284.1| 323|Homo sapiens 1,2-cyclic-inositol-phosp... 36 0.10 M20560-1|AAA59496.1| 323|Homo sapiens ANX3 protein. 36 0.10 L20591-1|AAA16713.1| 323|Homo sapiens annexin III protein. 36 0.10 CR541838-1|CAG46637.1| 316|Homo sapiens ANXA13 protein. 36 0.10 CR407648-1|CAG28576.1| 323|Homo sapiens ANXA3 protein. 36 0.10 BC125158-1|AAI25159.1| 316|Homo sapiens annexin A13 protein. 36 0.10 BC000871-1|AAH00871.1| 323|Homo sapiens annexin A3 protein. 36 0.10 AK223374-1|BAD97094.1| 316|Homo sapiens annexin A13 isoform a v... 36 0.10 AJ306450-1|CAC34622.1| 357|Homo sapiens annexin A13 isoform b p... 36 0.10 X12454-1|CAA30985.1| 320|Homo sapiens protein ( Human mRNA for ... 35 0.24 U05770-1|AAB60648.1| 320|Homo sapiens annexin V protein. 35 0.24 U01691-1|AAB40047.1| 320|Homo sapiens annexin V protein. 35 0.24 M21731-1|AAA36166.1| 320|Homo sapiens protein ( Human lipocorti... 35 0.24 M19384-1|AAB59545.1| 320|Homo sapiens anticoagulant protein 4 p... 35 0.24 M18366-1|AAA35570.1| 320|Homo sapiens protein ( Human placental... 35 0.24 J03745-1|AAA52386.1| 320|Homo sapiens ANX5 protein. 35 0.24 D00172-1|BAA00122.1| 320|Homo sapiens blood coagulation inhibit... 35 0.24 CR541842-1|CAG46640.1| 320|Homo sapiens ANXA5 protein. 35 0.24 CR536522-1|CAG38759.1| 320|Homo sapiens ANXA5 protein. 35 0.24 BC018671-1|AAH18671.1| 320|Homo sapiens annexin A5 protein. 35 0.24 BC012822-1|AAH12822.1| 320|Homo sapiens annexin A5 protein. 35 0.24 BC012804-1|AAH12804.1| 320|Homo sapiens annexin A5 protein. 35 0.24 BC004993-1|AAH04993.1| 320|Homo sapiens annexin A5 protein. 35 0.24 BC001429-1|AAH01429.1| 320|Homo sapiens ANXA5 protein protein. 35 0.24 AC096730-1|AAY40954.1| 320|Homo sapiens unknown protein. 35 0.24 M81844-1|AAB46383.1| 327|Homo sapiens anexin VIII protein. 34 0.31 L19605-1|AAA19734.1| 505|Homo sapiens 56K autoantigen protein. 34 0.31 CR450323-1|CAG29319.1| 505|Homo sapiens ANXA11 protein. 34 0.31 BT019934-1|AAV38737.1| 505|Homo sapiens annexin A11 protein. 34 0.31 BC007564-1|AAH07564.1| 505|Homo sapiens annexin A11 protein. 34 0.31 AL513174-2|CAI13916.1| 505|Homo sapiens annexin A11 protein. 34 0.31 AL356095-1|CAI40437.1| 505|Homo sapiens annexin A11 protein. 34 0.31 AK222918-1|BAD96638.1| 505|Homo sapiens annexin A11 variant pro... 34 0.31 AJ278465-1|CAB94997.1| 505|Homo sapiens annexin A11 protein. 34 0.31 AJ278464-1|CAB94996.1| 505|Homo sapiens annexin A11 protein. 34 0.31 AJ278463-1|CAB94995.1| 505|Homo sapiens annexin A11 protein. 34 0.31 AB209770-1|BAD93007.1| 510|Homo sapiens annexin A11 variant pro... 34 0.31 AB040888-1|BAA95979.2| 2450|Homo sapiens KIAA1455 protein protein. 33 0.55 BC007320-1|AAH07320.1| 324|Homo sapiens annexin A10 protein. 31 2.2 AY626137-1|AAT42216.1| 196|Homo sapiens putative annexin A10 sh... 31 2.2 AJ238979-1|CAB51917.1| 324|Homo sapiens annexin A10 protein pro... 31 2.2 AF196478-1|AAF06672.1| 324|Homo sapiens annexin 14 protein. 31 2.2 CR536481-1|CAG38720.1| 338|Homo sapiens ANXA9 protein. 31 2.9 BC005830-1|AAH05830.2| 338|Homo sapiens annexin A9 protein. 31 2.9 AL590133-11|CAI13335.1| 345|Homo sapiens annexin A9 protein. 31 2.9 AJ009985-1|CAA08933.1| 338|Homo sapiens annexin 31 (annexin XXX... 31 2.9 AF230929-1|AAG16780.1| 345|Homo sapiens keratinocyte annexin-li... 31 2.9 X05908-1|CAA29338.1| 346|Homo sapiens protein ( Homo sapiens mR... 30 6.7 CR407684-1|CAG28612.1| 346|Homo sapiens ANXA1 protein. 30 6.7 BT019917-1|AAV38720.1| 346|Homo sapiens annexin A1 protein. 30 6.7 BT019916-1|AAV38719.1| 346|Homo sapiens annexin A1 protein. 30 6.7 BT019896-1|AAV38699.1| 346|Homo sapiens annexin A1 protein. 30 6.7 BC035993-1|AAH35993.1| 346|Homo sapiens annexin A1 protein. 30 6.7 BC034157-1|AAH34157.1| 47|Homo sapiens ANXA1 protein protein. 30 6.7 BC001275-1|AAH01275.1| 346|Homo sapiens annexin A1 protein. 30 6.7 AL359997-4|CAI16496.1| 346|Homo sapiens annexin A1 protein. 30 6.7 BC101073-1|AAI01074.1| 841|Homo sapiens SLIT and NTRK-like fami... 29 8.9 BC101072-1|AAI01073.1| 841|Homo sapiens SLIT and NTRK-like fami... 29 8.9 BC101071-1|AAI01072.1| 841|Homo sapiens SLIT and NTRK-like fami... 29 8.9 BC101070-1|AAI01071.1| 841|Homo sapiens SLIT and NTRK-like fami... 29 8.9 AK026427-1|BAB15480.1| 440|Homo sapiens protein ( Homo sapiens ... 29 8.9 AK021931-1|BAB13941.1| 160|Homo sapiens protein ( Homo sapiens ... 29 8.9 >X16662-1|CAA34650.1| 327|Homo sapiens protein ( Human mRNA for vascular anticoagulant-beta (VAC-beta). ). Length = 327 Score = 41.1 bits (92), Expect = 0.003 Identities = 18/29 (62%), Positives = 23/29 (79%) Frame = +3 Query: 18 FLEKYGKSLETWIADDTSGDYKKALLTLV 104 F + YGK+L + I +DTSGDYK ALL+LV Sbjct: 295 FKKMYGKTLSSMIMEDTSGDYKNALLSLV 323 >BC073755-1|AAH73755.1| 327|Homo sapiens annexin A8 protein. Length = 327 Score = 41.1 bits (92), Expect = 0.003 Identities = 18/29 (62%), Positives = 23/29 (79%) Frame = +3 Query: 18 FLEKYGKSLETWIADDTSGDYKKALLTLV 104 F + YGK+L + I +DTSGDYK ALL+LV Sbjct: 295 FKKMYGKTLSSMIMEDTSGDYKNALLSLV 323 >BC008813-1|AAH08813.3| 276|Homo sapiens ANXA8 protein protein. Length = 276 Score = 41.1 bits (92), Expect = 0.003 Identities = 18/29 (62%), Positives = 23/29 (79%) Frame = +3 Query: 18 FLEKYGKSLETWIADDTSGDYKKALLTLV 104 F + YGK+L + I +DTSGDYK ALL+LV Sbjct: 244 FKKMYGKTLSSMIMEDTSGDYKNALLSLV 272 >BC004376-1|AAH04376.1| 327|Homo sapiens annexin A8-like 1 protein. Length = 327 Score = 41.1 bits (92), Expect = 0.003 Identities = 18/29 (62%), Positives = 23/29 (79%) Frame = +3 Query: 18 FLEKYGKSLETWIADDTSGDYKKALLTLV 104 F + YGK+L + I +DTSGDYK ALL+LV Sbjct: 295 FKKMYGKTLSSMIMEDTSGDYKNALLSLV 323 >AL603965-4|CAH70574.1| 327|Homo sapiens annexin A8-like 2 protein. Length = 327 Score = 41.1 bits (92), Expect = 0.003 Identities = 18/29 (62%), Positives = 23/29 (79%) Frame = +3 Query: 18 FLEKYGKSLETWIADDTSGDYKKALLTLV 104 F + YGK+L + I +DTSGDYK ALL+LV Sbjct: 295 FKKMYGKTLSSMIMEDTSGDYKNALLSLV 323 >AL603965-3|CAH70575.1| 276|Homo sapiens annexin A8-like 2 protein. Length = 276 Score = 41.1 bits (92), Expect = 0.003 Identities = 18/29 (62%), Positives = 23/29 (79%) Frame = +3 Query: 18 FLEKYGKSLETWIADDTSGDYKKALLTLV 104 F + YGK+L + I +DTSGDYK ALL+LV Sbjct: 244 FKKMYGKTLSSMIMEDTSGDYKNALLSLV 272 >AL591684-5|CAH72204.1| 276|Homo sapiens annexin A8 protein. Length = 276 Score = 41.1 bits (92), Expect = 0.003 Identities = 18/29 (62%), Positives = 23/29 (79%) Frame = +3 Query: 18 FLEKYGKSLETWIADDTSGDYKKALLTLV 104 F + YGK+L + I +DTSGDYK ALL+LV Sbjct: 244 FKKMYGKTLSSMIMEDTSGDYKNALLSLV 272 >AL591684-4|CAH72203.1| 327|Homo sapiens annexin A8 protein. Length = 327 Score = 41.1 bits (92), Expect = 0.003 Identities = 18/29 (62%), Positives = 23/29 (79%) Frame = +3 Query: 18 FLEKYGKSLETWIADDTSGDYKKALLTLV 104 F + YGK+L + I +DTSGDYK ALL+LV Sbjct: 295 FKKMYGKTLSSMIMEDTSGDYKNALLSLV 323 >AL391137-2|CAI12204.1| 276|Homo sapiens annexin A8-like 1 protein. Length = 276 Score = 41.1 bits (92), Expect = 0.003 Identities = 18/29 (62%), Positives = 23/29 (79%) Frame = +3 Query: 18 FLEKYGKSLETWIADDTSGDYKKALLTLV 104 F + YGK+L + I +DTSGDYK ALL+LV Sbjct: 244 FKKMYGKTLSSMIMEDTSGDYKNALLSLV 272 >AL391137-1|CAI12203.1| 327|Homo sapiens annexin A8-like 1 protein. Length = 327 Score = 41.1 bits (92), Expect = 0.003 Identities = 18/29 (62%), Positives = 23/29 (79%) Frame = +3 Query: 18 FLEKYGKSLETWIADDTSGDYKKALLTLV 104 F + YGK+L + I +DTSGDYK ALL+LV Sbjct: 295 FKKMYGKTLSSMIMEDTSGDYKNALLSLV 323 >AK223149-1|BAD96869.1| 327|Homo sapiens annexin A8 variant protein. Length = 327 Score = 41.1 bits (92), Expect = 0.003 Identities = 18/29 (62%), Positives = 23/29 (79%) Frame = +3 Query: 18 FLEKYGKSLETWIADDTSGDYKKALLTLV 104 F + YGK+L + I +DTSGDYK ALL+LV Sbjct: 295 FKKMYGKTLSSMIMEDTSGDYKNALLSLV 323 >D00017-1|BAA00013.1| 339|Homo sapiens lipocortin II protein. Length = 339 Score = 40.3 bits (90), Expect = 0.005 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F KYGKSL +I DT GDY+KALL L Sbjct: 304 RSEFKRKYGKSLYYYIQQDTKGDYQKALLYL 334 >BT007432-1|AAP36100.1| 339|Homo sapiens annexin A2 protein. Length = 339 Score = 40.3 bits (90), Expect = 0.005 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F KYGKSL +I DT GDY+KALL L Sbjct: 304 RSEFKRKYGKSLYYYIQQDTKGDYQKALLYL 334 >BC093056-1|AAH93056.1| 339|Homo sapiens ANXA2 protein protein. Length = 339 Score = 40.3 bits (90), Expect = 0.005 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F KYGKSL +I DT GDY+KALL L Sbjct: 304 RSEFKRKYGKSLYYYIQQDTKGDYQKALLYL 334 >BC068065-1|AAH68065.1| 339|Homo sapiens annexin A2 protein. Length = 339 Score = 40.3 bits (90), Expect = 0.005 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F KYGKSL +I DT GDY+KALL L Sbjct: 304 RSEFKRKYGKSLYYYIQQDTKGDYQKALLYL 334 >BC066955-1|AAH66955.2| 357|Homo sapiens ANXA2 protein protein. Length = 357 Score = 40.3 bits (90), Expect = 0.005 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F KYGKSL +I DT GDY+KALL L Sbjct: 322 RSEFKRKYGKSLYYYIQQDTKGDYQKALLYL 352 >BC052567-1|AAH52567.1| 339|Homo sapiens annexin A2 protein. Length = 339 Score = 40.3 bits (90), Expect = 0.005 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F KYGKSL +I DT GDY+KALL L Sbjct: 304 RSEFKRKYGKSLYYYIQQDTKGDYQKALLYL 334 >BC052558-1|AAH52558.1| 339|Homo sapiens annexin A2 protein. Length = 339 Score = 40.3 bits (90), Expect = 0.005 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F KYGKSL +I DT GDY+KALL L Sbjct: 304 RSEFKRKYGKSLYYYIQQDTKGDYQKALLYL 334 >BC023990-1|AAH23990.1| 339|Homo sapiens annexin A2 protein. Length = 339 Score = 40.3 bits (90), Expect = 0.005 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F KYGKSL +I DT GDY+KALL L Sbjct: 304 RSEFKRKYGKSLYYYIQQDTKGDYQKALLYL 334 >BC021114-1|AAH21114.1| 339|Homo sapiens annexin A2 protein. Length = 339 Score = 40.3 bits (90), Expect = 0.005 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F KYGKSL +I DT GDY+KALL L Sbjct: 304 RSEFKRKYGKSLYYYIQQDTKGDYQKALLYL 334 >BC016774-1|AAH16774.1| 339|Homo sapiens annexin A2 protein. Length = 339 Score = 40.3 bits (90), Expect = 0.005 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F KYGKSL +I DT GDY+KALL L Sbjct: 304 RSEFKRKYGKSLYYYIQQDTKGDYQKALLYL 334 >BC015834-1|AAH15834.1| 339|Homo sapiens annexin A2 protein. Length = 339 Score = 40.3 bits (90), Expect = 0.005 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F KYGKSL +I DT GDY+KALL L Sbjct: 304 RSEFKRKYGKSLYYYIQQDTKGDYQKALLYL 334 >BC009564-1|AAH09564.1| 339|Homo sapiens annexin A2 protein. Length = 339 Score = 40.3 bits (90), Expect = 0.005 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F KYGKSL +I DT GDY+KALL L Sbjct: 304 RSEFKRKYGKSLYYYIQQDTKGDYQKALLYL 334 >BC001388-1|AAH01388.1| 339|Homo sapiens annexin A2 protein. Length = 339 Score = 40.3 bits (90), Expect = 0.005 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F KYGKSL +I DT GDY+KALL L Sbjct: 304 RSEFKRKYGKSLYYYIQQDTKGDYQKALLYL 334 >Y00097-1|CAA68286.1| 673|Homo sapiens protein ( Human mRNA for protein p68. ). Length = 673 Score = 38.7 bits (86), Expect = 0.015 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F+EKY KSL I DTSGD+ KALL L Sbjct: 638 RREFIEKYDKSLHQAIEGDTSGDFLKALLAL 668 Score = 36.7 bits (81), Expect = 0.059 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F KY KSL + I +DTSG+YKK LL L Sbjct: 290 REIFRTKYEKSLYSMIKNDTSGEYKKTLLKL 320 Score = 31.5 bits (68), Expect = 2.2 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +3 Query: 15 AFLEKYGKSLETWIADDTSGDYKKALLTL 101 A+ E Y KSLE ++ DTSG +++ L++L Sbjct: 476 AYKEDYHKSLEDALSSDTSGHFRRILISL 504 >M82809-1|AAA51740.1| 321|Homo sapiens annexin IV (placental anticoagulant protein II) protein. Length = 321 Score = 38.7 bits (86), Expect = 0.015 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F YGKSL ++I DTSGDY+K LL L Sbjct: 286 RAHFKRLYGKSLYSFIKGDTSGDYRKVLLVL 316 >M19383-1|AAC41689.1| 321|Homo sapiens protein PP4-X protein. Length = 321 Score = 38.7 bits (86), Expect = 0.015 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F YGKSL ++I DTSGDY+K LL L Sbjct: 286 RAHFKRLYGKSLYSFIKGDTSGDYRKVLLVL 316 >J03578-1|AAA35656.1| 673|Homo sapiens protein ( Human calelectrin mRNA, complete cds. ). Length = 673 Score = 38.7 bits (86), Expect = 0.015 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F+EKY KSL I DTSGD+ KALL L Sbjct: 638 RREFIEKYDKSLHQAIEGDTSGDFLKALLAL 668 Score = 36.7 bits (81), Expect = 0.059 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F KY KSL + I +DTSG+YKK LL L Sbjct: 290 REIFRTKYEKSLYSMIKNDTSGEYKKTLLKL 320 Score = 31.5 bits (68), Expect = 2.2 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +3 Query: 15 AFLEKYGKSLETWIADDTSGDYKKALLTL 101 A+ E Y KSLE ++ DTSG +++ L++L Sbjct: 476 AYKEDYHKSLEDALSSDTSGHFRRILISL 504 >D78152-1|BAA11227.1| 321|Homo sapiens annexin IV (carbohydrtate-binding protein p33/41) protein. Length = 321 Score = 38.7 bits (86), Expect = 0.015 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F YGKSL ++I DTSGDY+K LL L Sbjct: 286 RAHFKRLYGKSLYSFIKGDTSGDYRKVLLVL 316 >D00510-1|BAA00400.1| 673|Homo sapiens calphobindin II protein. Length = 673 Score = 38.7 bits (86), Expect = 0.015 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F+EKY KSL I DTSGD+ KALL L Sbjct: 638 RREFIEKYDKSLHQAIEGDTSGDFLKALLAL 668 Score = 36.7 bits (81), Expect = 0.059 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F KY KSL + I +DTSG+YKK LL L Sbjct: 290 REIFRTKYEKSLYSMIKNDTSGEYKKTLLKL 320 Score = 31.5 bits (68), Expect = 2.2 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +3 Query: 15 AFLEKYGKSLETWIADDTSGDYKKALLTL 101 A+ E Y KSLE ++ DTSG +++ L++L Sbjct: 476 AYKEDYHKSLEDALSSDTSGHFRRILISL 504 >CR407681-1|CAG28609.1| 321|Homo sapiens ANXA4 protein. Length = 321 Score = 38.7 bits (86), Expect = 0.015 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F YGKSL ++I DTSGDY+K LL L Sbjct: 286 RAHFKRLYGKSLYSFIKGDTSGDYRKVLLVL 316 >BX641114-1|CAE46052.1| 112|Homo sapiens hypothetical protein protein. Length = 112 Score = 38.7 bits (86), Expect = 0.015 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F YGKSL ++I DTSGDY+K LL L Sbjct: 77 RAHFKRLYGKSLYSFIKGDTSGDYRKVLLVL 107 >BC063672-1|AAH63672.1| 299|Homo sapiens ANXA4 protein protein. Length = 299 Score = 38.7 bits (86), Expect = 0.015 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F YGKSL ++I DTSGDY+K LL L Sbjct: 264 RAHFKRLYGKSLYSFIKGDTSGDYRKVLLVL 294 >BC017046-1|AAH17046.1| 673|Homo sapiens annexin A6 protein. Length = 673 Score = 38.7 bits (86), Expect = 0.015 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F+EKY KSL I DTSGD+ KALL L Sbjct: 638 RREFIEKYDKSLHQAIEGDTSGDFLKALLAL 668 Score = 36.7 bits (81), Expect = 0.059 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F KY KSL + I +DTSG+YKK LL L Sbjct: 290 REIFRTKYEKSLYSMIKNDTSGEYKKTLLKL 320 Score = 31.5 bits (68), Expect = 2.2 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +3 Query: 15 AFLEKYGKSLETWIADDTSGDYKKALLTL 101 A+ E Y KSLE ++ DTSG +++ L++L Sbjct: 476 AYKEDYHKSLEDALSSDTSGHFRRILISL 504 >BC011659-1|AAH11659.1| 321|Homo sapiens annexin A4 protein. Length = 321 Score = 38.7 bits (86), Expect = 0.015 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F YGKSL ++I DTSGDY+K LL L Sbjct: 286 RAHFKRLYGKSLYSFIKGDTSGDYRKVLLVL 316 >BC000182-1|AAH00182.1| 321|Homo sapiens annexin A4 protein. Length = 321 Score = 38.7 bits (86), Expect = 0.015 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F YGKSL ++I DTSGDY+K LL L Sbjct: 286 RAHFKRLYGKSLYSFIKGDTSGDYRKVLLVL 316 >AY453398-1|AAS47515.1| 321|Homo sapiens proliferation-inducing protein 28 protein. Length = 321 Score = 38.7 bits (86), Expect = 0.015 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F YGKSL ++I DTSGDY+K LL L Sbjct: 286 RAHFKRLYGKSLYSFIKGDTSGDYRKVLLVL 316 >AK130077-1|BAC85290.1| 330|Homo sapiens protein ( Homo sapiens cDNA FLJ26567 fis, clone LNF05260, highly similar to Annexin VI. ). Length = 330 Score = 38.7 bits (86), Expect = 0.015 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F+EKY KSL I DTSGD+ KALL L Sbjct: 295 RREFIEKYDKSLHQAIEGDTSGDFLKALLAL 325 Score = 31.5 bits (68), Expect = 2.2 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +3 Query: 15 AFLEKYGKSLETWIADDTSGDYKKALLTL 101 A+ E Y KSLE ++ DTSG +++ L++L Sbjct: 133 AYKEDYHKSLEDALSSDTSGHFRRILISL 161 >AC019206-1|AAY14864.1| 321|Homo sapiens unknown protein. Length = 321 Score = 38.7 bits (86), Expect = 0.015 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F YGKSL ++I DTSGDY+K LL L Sbjct: 286 RAHFKRLYGKSLYSFIKGDTSGDYRKVLLVL 316 >AB209457-1|BAD92694.1| 225|Homo sapiens annexin IV variant protein. Length = 225 Score = 38.7 bits (86), Expect = 0.015 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F YGKSL ++I DTSGDY+K LL L Sbjct: 190 RAHFKRLYGKSLYSFIKGDTSGDYRKVLLVL 220 >J04543-1|AAA36616.1| 466|Homo sapiens protein ( Human synexin mRNA, complete cds. ). Length = 466 Score = 36.7 bits (81), Expect = 0.059 Identities = 16/29 (55%), Positives = 21/29 (72%) Frame = +3 Query: 18 FLEKYGKSLETWIADDTSGDYKKALLTLV 104 F + Y K+L T IA DTSGDY++ LL +V Sbjct: 436 FAQMYQKTLGTMIAGDTSGDYRRLLLAIV 464 >CR407686-1|CAG28614.1| 466|Homo sapiens ANXA7 protein. Length = 466 Score = 36.7 bits (81), Expect = 0.059 Identities = 16/29 (55%), Positives = 21/29 (72%) Frame = +3 Query: 18 FLEKYGKSLETWIADDTSGDYKKALLTLV 104 F + Y K+L T IA DTSGDY++ LL +V Sbjct: 436 FAQMYQKTLGTMIAGDTSGDYRRLLLAIV 464 >BT007187-1|AAP35851.1| 466|Homo sapiens annexin A7 protein. Length = 466 Score = 36.7 bits (81), Expect = 0.059 Identities = 16/29 (55%), Positives = 21/29 (72%) Frame = +3 Query: 18 FLEKYGKSLETWIADDTSGDYKKALLTLV 104 F + Y K+L T IA DTSGDY++ LL +V Sbjct: 436 FAQMYQKTLGTMIAGDTSGDYRRLLLAIV 464 >BC002632-1|AAH02632.1| 466|Homo sapiens annexin A7 protein. Length = 466 Score = 36.7 bits (81), Expect = 0.059 Identities = 16/29 (55%), Positives = 21/29 (72%) Frame = +3 Query: 18 FLEKYGKSLETWIADDTSGDYKKALLTLV 104 F + Y K+L T IA DTSGDY++ LL +V Sbjct: 436 FAQMYQKTLGTMIAGDTSGDYRRLLLAIV 464 >AL512656-2|CAI15291.1| 466|Homo sapiens annexin A7 protein. Length = 466 Score = 36.7 bits (81), Expect = 0.059 Identities = 16/29 (55%), Positives = 21/29 (72%) Frame = +3 Query: 18 FLEKYGKSLETWIADDTSGDYKKALLTLV 104 F + Y K+L T IA DTSGDY++ LL +V Sbjct: 436 FAQMYQKTLGTMIAGDTSGDYRRLLLAIV 464 >AL512656-1|CAI15290.1| 488|Homo sapiens annexin A7 protein. Length = 488 Score = 36.7 bits (81), Expect = 0.059 Identities = 16/29 (55%), Positives = 21/29 (72%) Frame = +3 Query: 18 FLEKYGKSLETWIADDTSGDYKKALLTLV 104 F + Y K+L T IA DTSGDY++ LL +V Sbjct: 458 FAQMYQKTLGTMIAGDTSGDYRRLLLAIV 486 >AL353731-4|CAI52485.1| 466|Homo sapiens annexin A7 protein. Length = 466 Score = 36.7 bits (81), Expect = 0.059 Identities = 16/29 (55%), Positives = 21/29 (72%) Frame = +3 Query: 18 FLEKYGKSLETWIADDTSGDYKKALLTLV 104 F + Y K+L T IA DTSGDY++ LL +V Sbjct: 436 FAQMYQKTLGTMIAGDTSGDYRRLLLAIV 464 >AL353731-3|CAI52484.1| 488|Homo sapiens annexin A7 protein. Length = 488 Score = 36.7 bits (81), Expect = 0.059 Identities = 16/29 (55%), Positives = 21/29 (72%) Frame = +3 Query: 18 FLEKYGKSLETWIADDTSGDYKKALLTLV 104 F + Y K+L T IA DTSGDY++ LL +V Sbjct: 458 FAQMYQKTLGTMIAGDTSGDYRRLLLAIV 486 >AK222552-1|BAD96272.1| 466|Homo sapiens annexin VII isoform 1 variant protein. Length = 466 Score = 36.7 bits (81), Expect = 0.059 Identities = 16/29 (55%), Positives = 21/29 (72%) Frame = +3 Query: 18 FLEKYGKSLETWIADDTSGDYKKALLTLV 104 F + Y K+L T IA DTSGDY++ LL +V Sbjct: 436 FAQMYQKTLGTMIAGDTSGDYRRLLLAIV 464 >AK126836-1|BAC86715.1| 509|Homo sapiens protein ( Homo sapiens cDNA FLJ44888 fis, clone BRAMY2041384, highly similar to Annexin VI. ). Length = 509 Score = 36.7 bits (81), Expect = 0.059 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F KY KSL + I +DTSG+YKK LL L Sbjct: 134 REIFRTKYEKSLYSMIKNDTSGEYKKTLLKL 164 Score = 31.5 bits (68), Expect = 2.2 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +3 Query: 15 AFLEKYGKSLETWIADDTSGDYKKALLTL 101 A+ E Y KSLE ++ DTSG +++ L++L Sbjct: 320 AYKEDYHKSLEDALSSDTSGHFRRILISL 348 >AB062429-1|BAB93492.1| 466|Homo sapiens annexin A7 protein. Length = 466 Score = 36.7 bits (81), Expect = 0.059 Identities = 16/29 (55%), Positives = 21/29 (72%) Frame = +3 Query: 18 FLEKYGKSLETWIADDTSGDYKKALLTLV 104 F + Y K+L T IA DTSGDY++ LL +V Sbjct: 436 FAQMYQKTLGTMIAGDTSGDYRRLLLAIV 464 >Z11502-1|CAA77578.1| 316|Homo sapiens intestine-specific annexin protein. Length = 316 Score = 35.9 bits (79), Expect = 0.10 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTLV 104 + F EKY KSL + DTSGD++K L+ L+ Sbjct: 284 KAKFQEKYQKSLSDMVRSDTSGDFRKLLVALL 315 Score = 31.1 bits (67), Expect = 2.9 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = +3 Query: 33 GKSLETWIADDTSGDYKKALLTLV 104 GK +E I ++TSGD +KA LTLV Sbjct: 217 GKDIEEAIEEETSGDLQKAYLTLV 240 >M63310-1|AAA52284.1| 323|Homo sapiens 1,2-cyclic-inositol-phosphate phosphodiesterase protein. Length = 323 Score = 35.9 bits (79), Expect = 0.10 Identities = 17/31 (54%), Positives = 22/31 (70%) Frame = +3 Query: 15 AFLEKYGKSLETWIADDTSGDYKKALLTLVD 107 A+ Y KSL I+ +TSGD++KALLTL D Sbjct: 131 AYYTVYKKSLGDDISSETSGDFRKALLTLAD 161 Score = 30.3 bits (65), Expect = 5.1 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F + YG SL + I DTSGDY+ LL + Sbjct: 288 RTEFKKHYGYSLYSAIKSDTSGDYEITLLKI 318 >M20560-1|AAA59496.1| 323|Homo sapiens ANX3 protein. Length = 323 Score = 35.9 bits (79), Expect = 0.10 Identities = 17/31 (54%), Positives = 22/31 (70%) Frame = +3 Query: 15 AFLEKYGKSLETWIADDTSGDYKKALLTLVD 107 A+ Y KSL I+ +TSGD++KALLTL D Sbjct: 131 AYYTVYKKSLGDDISSETSGDFRKALLTLAD 161 Score = 30.3 bits (65), Expect = 5.1 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F + YG SL + I DTSGDY+ LL + Sbjct: 288 RTEFKKHYGYSLYSAIKSDTSGDYEITLLKI 318 >L20591-1|AAA16713.1| 323|Homo sapiens annexin III protein. Length = 323 Score = 35.9 bits (79), Expect = 0.10 Identities = 17/31 (54%), Positives = 22/31 (70%) Frame = +3 Query: 15 AFLEKYGKSLETWIADDTSGDYKKALLTLVD 107 A+ Y KSL I+ +TSGD++KALLTL D Sbjct: 131 AYYTVYKKSLGDDISSETSGDFRKALLTLAD 161 Score = 30.3 bits (65), Expect = 5.1 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F + YG SL + I DTSGDY+ LL + Sbjct: 288 RTEFKKHYGYSLYSAIKSDTSGDYEITLLKI 318 >CR541838-1|CAG46637.1| 316|Homo sapiens ANXA13 protein. Length = 316 Score = 35.9 bits (79), Expect = 0.10 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTLV 104 + F EKY KSL + DTSGD++K L+ L+ Sbjct: 284 KAKFQEKYQKSLSDMVRSDTSGDFRKLLVALL 315 Score = 31.1 bits (67), Expect = 2.9 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = +3 Query: 33 GKSLETWIADDTSGDYKKALLTLV 104 GK +E I ++TSGD +KA LTLV Sbjct: 217 GKDIEEAIEEETSGDLQKAYLTLV 240 >CR407648-1|CAG28576.1| 323|Homo sapiens ANXA3 protein. Length = 323 Score = 35.9 bits (79), Expect = 0.10 Identities = 17/31 (54%), Positives = 22/31 (70%) Frame = +3 Query: 15 AFLEKYGKSLETWIADDTSGDYKKALLTLVD 107 A+ Y KSL I+ +TSGD++KALLTL D Sbjct: 131 AYYTVYKKSLGDDISSETSGDFRKALLTLAD 161 Score = 30.3 bits (65), Expect = 5.1 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F + YG SL + I DTSGDY+ LL + Sbjct: 288 RTEFKKHYGYSLYSAIKSDTSGDYEITLLKI 318 >BC125158-1|AAI25159.1| 316|Homo sapiens annexin A13 protein. Length = 316 Score = 35.9 bits (79), Expect = 0.10 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTLV 104 + F EKY KSL + DTSGD++K L+ L+ Sbjct: 284 KAKFQEKYQKSLSDMVRSDTSGDFRKLLVALL 315 Score = 31.1 bits (67), Expect = 2.9 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = +3 Query: 33 GKSLETWIADDTSGDYKKALLTLV 104 GK +E I ++TSGD +KA LTLV Sbjct: 217 GKDIEEAIEEETSGDLQKAYLTLV 240 >BC000871-1|AAH00871.1| 323|Homo sapiens annexin A3 protein. Length = 323 Score = 35.9 bits (79), Expect = 0.10 Identities = 17/31 (54%), Positives = 22/31 (70%) Frame = +3 Query: 15 AFLEKYGKSLETWIADDTSGDYKKALLTLVD 107 A+ Y KSL I+ +TSGD++KALLTL D Sbjct: 131 AYYTVYKKSLGDDISSETSGDFRKALLTLAD 161 Score = 30.3 bits (65), Expect = 5.1 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F + YG SL + I DTSGDY+ LL + Sbjct: 288 RTEFKKHYGYSLYSAIKSDTSGDYEITLLKI 318 >AK223374-1|BAD97094.1| 316|Homo sapiens annexin A13 isoform a variant protein. Length = 316 Score = 35.9 bits (79), Expect = 0.10 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTLV 104 + F EKY KSL + DTSGD++K L+ L+ Sbjct: 284 KAKFQEKYQKSLSDMVRSDTSGDFRKLLVALL 315 Score = 31.1 bits (67), Expect = 2.9 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = +3 Query: 33 GKSLETWIADDTSGDYKKALLTLV 104 GK +E I ++TSGD +KA LTLV Sbjct: 217 GKDIEEAIEEETSGDLQKAYLTLV 240 >AJ306450-1|CAC34622.1| 357|Homo sapiens annexin A13 isoform b protein. Length = 357 Score = 35.9 bits (79), Expect = 0.10 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTLV 104 + F EKY KSL + DTSGD++K L+ L+ Sbjct: 325 KAKFQEKYQKSLSDMVRSDTSGDFRKLLVALL 356 Score = 31.1 bits (67), Expect = 2.9 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = +3 Query: 33 GKSLETWIADDTSGDYKKALLTLV 104 GK +E I ++TSGD +KA LTLV Sbjct: 258 GKDIEEAIEEETSGDLQKAYLTLV 281 >X12454-1|CAA30985.1| 320|Homo sapiens protein ( Human mRNA for vascular anticoagulant. ). Length = 320 Score = 34.7 bits (76), Expect = 0.24 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F + + SL + I DTSGDYKKALL L Sbjct: 285 RKEFRKNFATSLYSMIKGDTSGDYKKALLLL 315 Score = 30.7 bits (66), Expect = 3.8 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 24 EKYGKSLETWIADDTSGDYKKALLTLV 104 E+YG SLE + DTSG Y++ L+ L+ Sbjct: 131 EEYGSSLEDDVVGDTSGYYQRMLVVLL 157 >U05770-1|AAB60648.1| 320|Homo sapiens annexin V protein. Length = 320 Score = 34.7 bits (76), Expect = 0.24 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F + + SL + I DTSGDYKKALL L Sbjct: 285 RKEFRKNFATSLYSMIKGDTSGDYKKALLLL 315 Score = 30.7 bits (66), Expect = 3.8 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 24 EKYGKSLETWIADDTSGDYKKALLTLV 104 E+YG SLE + DTSG Y++ L+ L+ Sbjct: 131 EEYGSSLEDDVVGDTSGYYQRMLVVLL 157 >U01691-1|AAB40047.1| 320|Homo sapiens annexin V protein. Length = 320 Score = 34.7 bits (76), Expect = 0.24 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F + + SL + I DTSGDYKKALL L Sbjct: 285 RKEFRKNFATSLYSMIKGDTSGDYKKALLLL 315 Score = 30.7 bits (66), Expect = 3.8 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 24 EKYGKSLETWIADDTSGDYKKALLTLV 104 E+YG SLE + DTSG Y++ L+ L+ Sbjct: 131 EEYGSSLEDDVVGDTSGYYQRMLVVLL 157 >M21731-1|AAA36166.1| 320|Homo sapiens protein ( Human lipocortin-V mRNA, complete cds. ). Length = 320 Score = 34.7 bits (76), Expect = 0.24 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F + + SL + I DTSGDYKKALL L Sbjct: 285 RKEFRKNFATSLYSMIKGDTSGDYKKALLLL 315 Score = 30.7 bits (66), Expect = 3.8 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 24 EKYGKSLETWIADDTSGDYKKALLTLV 104 E+YG SLE + DTSG Y++ L+ L+ Sbjct: 131 EEYGSSLEDDVVGDTSGYYQRMLVVLL 157 >M19384-1|AAB59545.1| 320|Homo sapiens anticoagulant protein 4 protein. Length = 320 Score = 34.7 bits (76), Expect = 0.24 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F + + SL + I DTSGDYKKALL L Sbjct: 285 RKEFRKNFATSLYSMIKGDTSGDYKKALLLL 315 Score = 30.7 bits (66), Expect = 3.8 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 24 EKYGKSLETWIADDTSGDYKKALLTLV 104 E+YG SLE + DTSG Y++ L+ L+ Sbjct: 131 EEYGSSLEDDVVGDTSGYYQRMLVVLL 157 >M18366-1|AAA35570.1| 320|Homo sapiens protein ( Human placental anticoagulant protein (PAP) mRNA, complete cds. ). Length = 320 Score = 34.7 bits (76), Expect = 0.24 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F + + SL + I DTSGDYKKALL L Sbjct: 285 RKEFRKNFATSLYSMIKGDTSGDYKKALLLL 315 Score = 30.7 bits (66), Expect = 3.8 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 24 EKYGKSLETWIADDTSGDYKKALLTLV 104 E+YG SLE + DTSG Y++ L+ L+ Sbjct: 131 EEYGSSLEDDVVGDTSGYYQRMLVVLL 157 >J03745-1|AAA52386.1| 320|Homo sapiens ANX5 protein. Length = 320 Score = 34.7 bits (76), Expect = 0.24 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F + + SL + I DTSGDYKKALL L Sbjct: 285 RKEFRKNFATSLYSMIKGDTSGDYKKALLLL 315 Score = 30.7 bits (66), Expect = 3.8 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 24 EKYGKSLETWIADDTSGDYKKALLTLV 104 E+YG SLE + DTSG Y++ L+ L+ Sbjct: 131 EEYGSSLEDDVVGDTSGYYQRMLVVLL 157 >D00172-1|BAA00122.1| 320|Homo sapiens blood coagulation inhibitor protein. Length = 320 Score = 34.7 bits (76), Expect = 0.24 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F + + SL + I DTSGDYKKALL L Sbjct: 285 RKEFRKNFATSLYSMIKGDTSGDYKKALLLL 315 Score = 30.7 bits (66), Expect = 3.8 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 24 EKYGKSLETWIADDTSGDYKKALLTLV 104 E+YG SLE + DTSG Y++ L+ L+ Sbjct: 131 EEYGSSLEDDVVGDTSGYYQRMLVVLL 157 >CR541842-1|CAG46640.1| 320|Homo sapiens ANXA5 protein. Length = 320 Score = 34.7 bits (76), Expect = 0.24 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F + + SL + I DTSGDYKKALL L Sbjct: 285 RKEFRKNFATSLYSMIKGDTSGDYKKALLLL 315 Score = 30.7 bits (66), Expect = 3.8 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 24 EKYGKSLETWIADDTSGDYKKALLTLV 104 E+YG SLE + DTSG Y++ L+ L+ Sbjct: 131 EEYGSSLEDDVVGDTSGYYQRMLVVLL 157 >CR536522-1|CAG38759.1| 320|Homo sapiens ANXA5 protein. Length = 320 Score = 34.7 bits (76), Expect = 0.24 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F + + SL + I DTSGDYKKALL L Sbjct: 285 RKEFRKNFATSLYSMIKGDTSGDYKKALLLL 315 Score = 29.9 bits (64), Expect = 6.7 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 24 EKYGKSLETWIADDTSGDYKKALLTLV 104 E+YG SLE + DTSG Y++ L+ L+ Sbjct: 131 EEYGLSLEDDVVGDTSGYYQRMLVVLL 157 >BC018671-1|AAH18671.1| 320|Homo sapiens annexin A5 protein. Length = 320 Score = 34.7 bits (76), Expect = 0.24 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F + + SL + I DTSGDYKKALL L Sbjct: 285 RKEFRKNFATSLYSMIKGDTSGDYKKALLLL 315 Score = 30.7 bits (66), Expect = 3.8 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 24 EKYGKSLETWIADDTSGDYKKALLTLV 104 E+YG SLE + DTSG Y++ L+ L+ Sbjct: 131 EEYGSSLEDDVVGDTSGYYQRMLVVLL 157 >BC012822-1|AAH12822.1| 320|Homo sapiens annexin A5 protein. Length = 320 Score = 34.7 bits (76), Expect = 0.24 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F + + SL + I DTSGDYKKALL L Sbjct: 285 RKEFRKNFATSLYSMIKGDTSGDYKKALLLL 315 Score = 30.7 bits (66), Expect = 3.8 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 24 EKYGKSLETWIADDTSGDYKKALLTLV 104 E+YG SLE + DTSG Y++ L+ L+ Sbjct: 131 EEYGSSLEDDVVGDTSGYYQRMLVVLL 157 >BC012804-1|AAH12804.1| 320|Homo sapiens annexin A5 protein. Length = 320 Score = 34.7 bits (76), Expect = 0.24 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F + + SL + I DTSGDYKKALL L Sbjct: 285 RKEFRKNFATSLYSMIKGDTSGDYKKALLLL 315 Score = 30.7 bits (66), Expect = 3.8 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 24 EKYGKSLETWIADDTSGDYKKALLTLV 104 E+YG SLE + DTSG Y++ L+ L+ Sbjct: 131 EEYGSSLEDDVVGDTSGYYQRMLVVLL 157 >BC004993-1|AAH04993.1| 320|Homo sapiens annexin A5 protein. Length = 320 Score = 34.7 bits (76), Expect = 0.24 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F + + SL + I DTSGDYKKALL L Sbjct: 285 RKEFRKNFATSLYSMIKGDTSGDYKKALLLL 315 Score = 30.7 bits (66), Expect = 3.8 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 24 EKYGKSLETWIADDTSGDYKKALLTLV 104 E+YG SLE + DTSG Y++ L+ L+ Sbjct: 131 EEYGSSLEDDVVGDTSGYYQRMLVVLL 157 >BC001429-1|AAH01429.1| 320|Homo sapiens ANXA5 protein protein. Length = 320 Score = 34.7 bits (76), Expect = 0.24 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F + + SL + I DTSGDYKKALL L Sbjct: 285 RKEFRKNFATSLYSMIKGDTSGDYKKALLLL 315 Score = 30.7 bits (66), Expect = 3.8 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 24 EKYGKSLETWIADDTSGDYKKALLTLV 104 E+YG SLE + DTSG Y++ L+ L+ Sbjct: 131 EEYGSSLEDDVVGDTSGYYQRMLVVLL 157 >AC096730-1|AAY40954.1| 320|Homo sapiens unknown protein. Length = 320 Score = 34.7 bits (76), Expect = 0.24 Identities = 17/31 (54%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R F + + SL + I DTSGDYKKALL L Sbjct: 285 RKEFRKNFATSLYSMIKGDTSGDYKKALLLL 315 Score = 30.7 bits (66), Expect = 3.8 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +3 Query: 24 EKYGKSLETWIADDTSGDYKKALLTLV 104 E+YG SLE + DTSG Y++ L+ L+ Sbjct: 131 EEYGSSLEDDVVGDTSGYYQRMLVVLL 157 >M81844-1|AAB46383.1| 327|Homo sapiens anexin VIII protein. Length = 327 Score = 34.3 bits (75), Expect = 0.31 Identities = 16/29 (55%), Positives = 21/29 (72%) Frame = +3 Query: 18 FLEKYGKSLETWIADDTSGDYKKALLTLV 104 F + YGK+L + I +DTS YK ALL+LV Sbjct: 295 FKKMYGKTLSSMIMEDTSRYYKNALLSLV 323 >L19605-1|AAA19734.1| 505|Homo sapiens 56K autoantigen protein. Length = 505 Score = 34.3 bits (75), Expect = 0.31 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R + YGKSL I+ DTSGDY+K LL + Sbjct: 470 RSEYKRMYGKSLYHDISGDTSGDYRKILLKI 500 >CR450323-1|CAG29319.1| 505|Homo sapiens ANXA11 protein. Length = 505 Score = 34.3 bits (75), Expect = 0.31 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R + YGKSL I+ DTSGDY+K LL + Sbjct: 470 RSEYKRMYGKSLYHDISGDTSGDYRKILLKI 500 >BT019934-1|AAV38737.1| 505|Homo sapiens annexin A11 protein. Length = 505 Score = 34.3 bits (75), Expect = 0.31 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R + YGKSL I+ DTSGDY+K LL + Sbjct: 470 RSEYKRMYGKSLYHDISGDTSGDYRKILLKI 500 >BC007564-1|AAH07564.1| 505|Homo sapiens annexin A11 protein. Length = 505 Score = 34.3 bits (75), Expect = 0.31 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R + YGKSL I+ DTSGDY+K LL + Sbjct: 470 RSEYKRMYGKSLYHDISGDTSGDYRKILLKI 500 >AL513174-2|CAI13916.1| 505|Homo sapiens annexin A11 protein. Length = 505 Score = 34.3 bits (75), Expect = 0.31 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R + YGKSL I+ DTSGDY+K LL + Sbjct: 470 RSEYKRMYGKSLYHDISGDTSGDYRKILLKI 500 >AL356095-1|CAI40437.1| 505|Homo sapiens annexin A11 protein. Length = 505 Score = 34.3 bits (75), Expect = 0.31 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R + YGKSL I+ DTSGDY+K LL + Sbjct: 470 RSEYKRMYGKSLYHDISGDTSGDYRKILLKI 500 >AK222918-1|BAD96638.1| 505|Homo sapiens annexin A11 variant protein. Length = 505 Score = 34.3 bits (75), Expect = 0.31 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R + YGKSL I+ DTSGDY+K LL + Sbjct: 470 RSEYKRMYGKSLYHDISGDTSGDYRKILLKI 500 >AJ278465-1|CAB94997.1| 505|Homo sapiens annexin A11 protein. Length = 505 Score = 34.3 bits (75), Expect = 0.31 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R + YGKSL I+ DTSGDY+K LL + Sbjct: 470 RSEYKRMYGKSLYHDISGDTSGDYRKILLKI 500 >AJ278464-1|CAB94996.1| 505|Homo sapiens annexin A11 protein. Length = 505 Score = 34.3 bits (75), Expect = 0.31 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R + YGKSL I+ DTSGDY+K LL + Sbjct: 470 RSEYKRMYGKSLYHDISGDTSGDYRKILLKI 500 >AJ278463-1|CAB94995.1| 505|Homo sapiens annexin A11 protein. Length = 505 Score = 34.3 bits (75), Expect = 0.31 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R + YGKSL I+ DTSGDY+K LL + Sbjct: 470 RSEYKRMYGKSLYHDISGDTSGDYRKILLKI 500 >AB209770-1|BAD93007.1| 510|Homo sapiens annexin A11 variant protein. Length = 510 Score = 34.3 bits (75), Expect = 0.31 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R + YGKSL I+ DTSGDY+K LL + Sbjct: 475 RSEYKRMYGKSLYHDISGDTSGDYRKILLKI 505 >AB040888-1|BAA95979.2| 2450|Homo sapiens KIAA1455 protein protein. Length = 2450 Score = 33.5 bits (73), Expect = 0.55 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 Query: 102 QGSTKPSCNLRMCHQRSRSPGTCRTSR 22 +G T P+CN R CH R GTC+ + Sbjct: 451 EGWTGPACNQRACHPRCAEHGTCKDGK 477 >BC007320-1|AAH07320.1| 324|Homo sapiens annexin A10 protein. Length = 324 Score = 31.5 bits (68), Expect = 2.2 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R + E+YGKSL I + SG YKKALL + Sbjct: 286 RKRYKERYGKSLFHDIRNFASGHYKKALLAI 316 >AY626137-1|AAT42216.1| 196|Homo sapiens putative annexin A10 short isoform protein. Length = 196 Score = 31.5 bits (68), Expect = 2.2 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R + E+YGKSL I + SG YKKALL + Sbjct: 158 RKRYKERYGKSLFHDIRNFASGHYKKALLAI 188 >AJ238979-1|CAB51917.1| 324|Homo sapiens annexin A10 protein protein. Length = 324 Score = 31.5 bits (68), Expect = 2.2 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R + E+YGKSL I + SG YKKALL + Sbjct: 286 RKRYKERYGKSLFHDIRNFASGHYKKALLAI 316 >AF196478-1|AAF06672.1| 324|Homo sapiens annexin 14 protein. Length = 324 Score = 31.5 bits (68), Expect = 2.2 Identities = 16/31 (51%), Positives = 20/31 (64%) Frame = +3 Query: 9 RGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 R + E+YGKSL I + SG YKKALL + Sbjct: 286 RKRYKERYGKSLFHDIRNFASGHYKKALLAI 316 >CR536481-1|CAG38720.1| 338|Homo sapiens ANXA9 protein. Length = 338 Score = 31.1 bits (67), Expect = 2.9 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +3 Query: 3 SARGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 S R F +K+GKSL + + D GD + ALL L Sbjct: 300 SIRAEFRKKFGKSLYSSLQDAVKGDCQSALLAL 332 >BC005830-1|AAH05830.2| 338|Homo sapiens annexin A9 protein. Length = 338 Score = 31.1 bits (67), Expect = 2.9 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +3 Query: 3 SARGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 S R F +K+GKSL + + D GD + ALL L Sbjct: 300 SIRAEFRKKFGKSLYSSLQDAVKGDCQSALLAL 332 >AL590133-11|CAI13335.1| 345|Homo sapiens annexin A9 protein. Length = 345 Score = 31.1 bits (67), Expect = 2.9 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +3 Query: 3 SARGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 S R F +K+GKSL + + D GD + ALL L Sbjct: 307 SIRAEFRKKFGKSLYSSLQDAVKGDCQSALLAL 339 >AJ009985-1|CAA08933.1| 338|Homo sapiens annexin 31 (annexin XXXI) protein. Length = 338 Score = 31.1 bits (67), Expect = 2.9 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +3 Query: 3 SARGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 S R F +K+GKSL + + D GD + ALL L Sbjct: 300 SIRAEFRKKFGKSLYSSLQDAVKGDCQSALLAL 332 >AF230929-1|AAG16780.1| 345|Homo sapiens keratinocyte annexin-like protein pemphaxin protein. Length = 345 Score = 31.1 bits (67), Expect = 2.9 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +3 Query: 3 SARGAFLEKYGKSLETWIADDTSGDYKKALLTL 101 S R F +K+GKSL + + D GD + ALL L Sbjct: 307 SIRAEFRKKFGKSLYSSLQDAVKGDCQSALLAL 339 >X05908-1|CAA29338.1| 346|Homo sapiens protein ( Homo sapiens mRNA for lipocortin. ). Length = 346 Score = 29.9 bits (64), Expect = 6.7 Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +3 Query: 15 AFLEK-YGKSLETWIADDTSGDYKKALLTL 101 AF +K YG SL I D+T GDY+K L+ L Sbjct: 313 AFYQKMYGISLCQAILDETKGDYEKILVAL 342 >CR407684-1|CAG28612.1| 346|Homo sapiens ANXA1 protein. Length = 346 Score = 29.9 bits (64), Expect = 6.7 Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +3 Query: 15 AFLEK-YGKSLETWIADDTSGDYKKALLTL 101 AF +K YG SL I D+T GDY+K L+ L Sbjct: 313 AFYQKMYGISLCQAILDETKGDYEKILVAL 342 >BT019917-1|AAV38720.1| 346|Homo sapiens annexin A1 protein. Length = 346 Score = 29.9 bits (64), Expect = 6.7 Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +3 Query: 15 AFLEK-YGKSLETWIADDTSGDYKKALLTL 101 AF +K YG SL I D+T GDY+K L+ L Sbjct: 313 AFYQKMYGISLCQAILDETKGDYEKILVAL 342 >BT019916-1|AAV38719.1| 346|Homo sapiens annexin A1 protein. Length = 346 Score = 29.9 bits (64), Expect = 6.7 Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +3 Query: 15 AFLEK-YGKSLETWIADDTSGDYKKALLTL 101 AF +K YG SL I D+T GDY+K L+ L Sbjct: 313 AFYQKMYGISLCQAILDETKGDYEKILVAL 342 >BT019896-1|AAV38699.1| 346|Homo sapiens annexin A1 protein. Length = 346 Score = 29.9 bits (64), Expect = 6.7 Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +3 Query: 15 AFLEK-YGKSLETWIADDTSGDYKKALLTL 101 AF +K YG SL I D+T GDY+K L+ L Sbjct: 313 AFYQKMYGISLCQAILDETKGDYEKILVAL 342 >BC035993-1|AAH35993.1| 346|Homo sapiens annexin A1 protein. Length = 346 Score = 29.9 bits (64), Expect = 6.7 Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +3 Query: 15 AFLEK-YGKSLETWIADDTSGDYKKALLTL 101 AF +K YG SL I D+T GDY+K L+ L Sbjct: 313 AFYQKMYGISLCQAILDETKGDYEKILVAL 342 >BC034157-1|AAH34157.1| 47|Homo sapiens ANXA1 protein protein. Length = 47 Score = 29.9 bits (64), Expect = 6.7 Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +3 Query: 15 AFLEK-YGKSLETWIADDTSGDYKKALLTL 101 AF +K YG SL I D+T GDY+K L+ L Sbjct: 14 AFYQKMYGISLCQAILDETKGDYEKILVAL 43 >BC001275-1|AAH01275.1| 346|Homo sapiens annexin A1 protein. Length = 346 Score = 29.9 bits (64), Expect = 6.7 Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +3 Query: 15 AFLEK-YGKSLETWIADDTSGDYKKALLTL 101 AF +K YG SL I D+T GDY+K L+ L Sbjct: 313 AFYQKMYGISLCQAILDETKGDYEKILVAL 342 >AL359997-4|CAI16496.1| 346|Homo sapiens annexin A1 protein. Length = 346 Score = 29.9 bits (64), Expect = 6.7 Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +3 Query: 15 AFLEK-YGKSLETWIADDTSGDYKKALLTL 101 AF +K YG SL I D+T GDY+K L+ L Sbjct: 313 AFYQKMYGISLCQAILDETKGDYEKILVAL 342 >BC101073-1|AAI01074.1| 841|Homo sapiens SLIT and NTRK-like family, member 6 protein. Length = 841 Score = 29.5 bits (63), Expect = 8.9 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -1 Query: 544 VLTPSGLVTHCREEVAEGTSD 482 VL+PSGL+ HC+E E SD Sbjct: 337 VLSPSGLLIHCQERNIESLSD 357 >BC101072-1|AAI01073.1| 841|Homo sapiens SLIT and NTRK-like family, member 6 protein. Length = 841 Score = 29.5 bits (63), Expect = 8.9 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -1 Query: 544 VLTPSGLVTHCREEVAEGTSD 482 VL+PSGL+ HC+E E SD Sbjct: 337 VLSPSGLLIHCQERNIESLSD 357 >BC101071-1|AAI01072.1| 841|Homo sapiens SLIT and NTRK-like family, member 6 protein. Length = 841 Score = 29.5 bits (63), Expect = 8.9 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -1 Query: 544 VLTPSGLVTHCREEVAEGTSD 482 VL+PSGL+ HC+E E SD Sbjct: 337 VLSPSGLLIHCQERNIESLSD 357 >BC101070-1|AAI01071.1| 841|Homo sapiens SLIT and NTRK-like family, member 6 protein. Length = 841 Score = 29.5 bits (63), Expect = 8.9 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -1 Query: 544 VLTPSGLVTHCREEVAEGTSD 482 VL+PSGL+ HC+E E SD Sbjct: 337 VLSPSGLLIHCQERNIESLSD 357 >AK026427-1|BAB15480.1| 440|Homo sapiens protein ( Homo sapiens cDNA: FLJ22774 fis, clone KAIA1575. ). Length = 440 Score = 29.5 bits (63), Expect = 8.9 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -1 Query: 544 VLTPSGLVTHCREEVAEGTSD 482 VL+PSGL+ HC+E E SD Sbjct: 294 VLSPSGLLIHCQERNIESLSD 314 >AK021931-1|BAB13941.1| 160|Homo sapiens protein ( Homo sapiens cDNA FLJ11869 fis, clone HEMBA1007002. ). Length = 160 Score = 29.5 bits (63), Expect = 8.9 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -1 Query: 544 VLTPSGLVTHCREEVAEGTSD 482 VL+PSGL+ HC+E E SD Sbjct: 102 VLSPSGLLIHCQERNIESLSD 122 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 82,174,381 Number of Sequences: 237096 Number of extensions: 1659350 Number of successful extensions: 3826 Number of sequences better than 10.0: 114 Number of HSP's better than 10.0 without gapping: 3564 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3826 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5929224630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -