BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0771 (631 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44970| Best HMM Match : Neur_chan_LBD (HMM E-Value=0) 29 3.1 SB_29982| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 >SB_44970| Best HMM Match : Neur_chan_LBD (HMM E-Value=0) Length = 506 Score = 29.1 bits (62), Expect = 3.1 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +1 Query: 247 VSSEEDSVLKFLQTFDELSTIIKVTFGWGKLNGNV 351 V+SE+D KFL FDEL I +NGN+ Sbjct: 331 VTSEQDRESKFLHEFDELPDIENAYTPLPSMNGNL 365 >SB_29982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 27.5 bits (58), Expect = 9.5 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -3 Query: 380 IPSTRNFVIYTFPLSLPHPNVTLIIVLSSSNVC 282 +PST N ++Y+ +S N T ++ L S C Sbjct: 15 VPSTTNVILYSIMISCAEYNRTALVSLVYSGTC 47 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,813,230 Number of Sequences: 59808 Number of extensions: 275208 Number of successful extensions: 729 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 513 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 729 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1572561250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -