BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0769 (476 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1D7.02c |scr1||transcription factor Scr1|Schizosaccharomyces... 29 0.48 SPAC821.13c ||SPAC955.01c|P-type ATPase |Schizosaccharomyces pom... 25 5.9 >SPBC1D7.02c |scr1||transcription factor Scr1|Schizosaccharomyces pombe|chr 2|||Manual Length = 565 Score = 28.7 bits (61), Expect = 0.48 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -1 Query: 254 ISHPHHYKR*SMQMNLNMEINGYPRN*PFEA 162 +S+PHHY Q NG P N P +A Sbjct: 153 MSYPHHYSASVQQQQATFVSNGQPHNLPAQA 183 >SPAC821.13c ||SPAC955.01c|P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1562 Score = 25.0 bits (52), Expect = 5.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +1 Query: 298 HRTFSKFFTHFCLNVAIC 351 H TFSK F LN+AIC Sbjct: 754 HTTFSKRVRIFLLNLAIC 771 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,716,944 Number of Sequences: 5004 Number of extensions: 32110 Number of successful extensions: 52 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 50 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 52 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 184476110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -