BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0769 (476 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL032623-18|CAN99758.1| 330|Caenorhabditis elegans Hypothetical... 28 4.0 Z83229-3|CAB05740.3| 369|Caenorhabditis elegans Hypothetical pr... 27 5.3 >AL032623-18|CAN99758.1| 330|Caenorhabditis elegans Hypothetical protein Y43F8B.15 protein. Length = 330 Score = 27.9 bits (59), Expect = 4.0 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -1 Query: 338 FKQK*VKNFEKVLCTECLVRVF*FIFNY-ISHPHHY 234 F +K + +KVLC E ++ F +F+ HPH Y Sbjct: 90 FHKKGCTDSQKVLCNEVIITTFHALFDLKKQHPHDY 125 >Z83229-3|CAB05740.3| 369|Caenorhabditis elegans Hypothetical protein F54F11.3 protein. Length = 369 Score = 27.5 bits (58), Expect = 5.3 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 4/58 (6%) Frame = +3 Query: 228 SFVVMWMRYIIENK--LKNSH*ALGT*NFLEVFHSFLF--KCCYMLFHLKWSS*NCTI 389 ++ V + +I+E+ LK + L F+ F SF + KCCY+ H+K N T+ Sbjct: 11 NYTVCFPIFILEDTRALKFPYSMLQALEFVLTFVSFYYVIKCCYVAIHIKSFHRNLTV 68 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,239,248 Number of Sequences: 27780 Number of extensions: 173005 Number of successful extensions: 313 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 313 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 313 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 871571276 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -