BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0768 (528 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 24 1.1 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 21 5.9 AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. 21 5.9 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 23.8 bits (49), Expect = 1.1 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -2 Query: 143 PGGGSDVLYTSEGGYSG 93 PG G DVL T E +SG Sbjct: 490 PGFGKDVLATDERSFSG 506 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 21.4 bits (43), Expect = 5.9 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +2 Query: 377 NAHALHGVPPMLSSVLPETSQPSSSRPSLFK 469 NA +GV M ++L T + + P++FK Sbjct: 112 NADGEYGVTTMTKAILHYTGKVLWTPPAIFK 142 >AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. Length = 238 Score = 21.4 bits (43), Expect = 5.9 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -2 Query: 143 PGGGSDVLYTSEGGYS 96 PG G DVL T E +S Sbjct: 196 PGFGKDVLATDERSFS 211 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,638 Number of Sequences: 438 Number of extensions: 3155 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14845611 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -