BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0767 (593 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC19A8.03 |||phosphatidylinositol-3-phosphatase |Schizosacchar... 27 2.1 SPAC22G7.08 |ppk8||serine/threonine protein kinase Ppk8 |Schizos... 25 6.3 >SPAC19A8.03 |||phosphatidylinositol-3-phosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 559 Score = 27.1 bits (57), Expect = 2.1 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 2/50 (4%) Frame = +3 Query: 234 KSVCIVNEYSDFFHLCW*I--TLSFRNVYGKL*YKYTYKSYNLFYYSYFI 377 KS CI + DF CW T +VY L + S N+ Y Y++ Sbjct: 60 KSFCIRIQCRDFMFFCWRFQSTEDAMDVYDTLQELMSINSINMLYAFYYM 109 >SPAC22G7.08 |ppk8||serine/threonine protein kinase Ppk8 |Schizosaccharomyces pombe|chr 1|||Manual Length = 513 Score = 25.4 bits (53), Expect = 6.3 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -1 Query: 458 SLKKFNWKVKHTQERNLIL 402 +LK+F WKV HT ++ L Sbjct: 438 ALKRFPWKVPHTSDKRFNL 456 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,997,813 Number of Sequences: 5004 Number of extensions: 36087 Number of successful extensions: 78 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 78 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 258201856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -