BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= P5PG0767 (593 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 25 0.56 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 24 0.98 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 5.2 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 21 9.1 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 25.0 bits (52), Expect = 0.56 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Frame = +3 Query: 291 TLSFRNVYGKL*YKYTYKSYN--LFYYSYFI 377 +LS Y YKY Y +YN L+Y +Y I Sbjct: 317 SLSNNYNYNNNNYKYNYNNYNKKLYYKNYII 347 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 24.2 bits (50), Expect = 0.98 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -3 Query: 426 YPGKKPDIKNKALRDEL*NNYNKI 355 +PG + + K L D+L +NYN++ Sbjct: 12 FPGASANSEAKRLYDDLLSNYNRL 35 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.8 bits (44), Expect = 5.2 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -1 Query: 269 KIRIFIYNTNTFRKILSYNKKPQLCT 192 K+R IY T F + + N + LC+ Sbjct: 16 KLRNLIYKTEAFDSLHAGNAEKTLCS 41 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 21.0 bits (42), Expect = 9.1 Identities = 13/51 (25%), Positives = 22/51 (43%) Frame = -1 Query: 530 TEPFSCSKMDLKHGLLKNFY*NRRSLKKFNWKVKHTQERNLILKTKL*GMS 378 TEP + + + +K F N+ L + N + N+I+ K MS Sbjct: 388 TEPSTTTSTTISQKHIKVFVVNKDILHEHNVDDNEDHDENMIIPPKKSDMS 438 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,704 Number of Sequences: 438 Number of extensions: 2601 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17359926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -